Homologs in group_2519

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_00020 EHELCC_00020 100.0 Morganella morganii S2 dapA 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase
NLDBIP_03440 NLDBIP_03440 100.0 Morganella morganii S4 dapA 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase
LHKJJB_04955 LHKJJB_04955 100.0 Morganella morganii S3 dapA 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase
HKOGLL_02090 HKOGLL_02090 100.0 Morganella morganii S5 dapA 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase
PMI_RS05950 PMI_RS05950 28.5 Proteus mirabilis HI4320 - dihydrodipicolinate synthase family protein

Distribution of the homologs in the orthogroup group_2519

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2519

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75682 8.98e-50 170 31 1 285 1 yagE Putative 2-dehydro-3-deoxy-D-gluconate aldolase YagE Escherichia coli (strain K12)
P39359 1.43e-49 169 31 2 290 1 yjhH Probable 2-dehydro-3-deoxy-D-pentonate aldolase YjhH Escherichia coli (strain K12)
B1LBR1 1.29e-36 135 27 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermotoga sp. (strain RQ2)
Q9X1K9 2.62e-36 134 27 4 288 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A1VCZ9 2.69e-36 134 29 5 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitratidesulfovibrio vulgaris (strain DP4)
Q72AX2 2.69e-36 134 29 5 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B9K865 2.76e-36 134 28 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B6YU51 2.78e-36 134 31 4 294 3 dapAL Uncharacterized DapA-like lyase TON_0506 Thermococcus onnurineus (strain NA1)
B8DKU0 3.93e-36 134 29 5 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q5JGK8 1.19e-35 133 31 4 293 3 dapAL Uncharacterized DapA-like lyase TK1237 Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
A5IM62 1.96e-35 132 27 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
C5CHX9 2.15e-35 132 29 3 267 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A7HJ56 2.46e-35 132 31 3 260 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q310Q2 5.65e-35 131 30 5 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A7Z4U8 9.82e-35 130 31 8 300 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
O58577 3.42e-34 129 29 4 287 3 dapAL Uncharacterized DapA-like lyase PH0847 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q04796 8.86e-34 128 32 5 262 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bacillus subtilis (strain 168)
O29352 1.02e-33 127 29 6 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A3CVI7 3.33e-33 126 31 8 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
A1S0T1 7e-33 125 29 3 294 3 dapAL Uncharacterized DapA-like lyase Tpen_1666 Thermofilum pendens (strain DSM 2475 / Hrk 5)
B5YKK4 1.69e-32 124 29 6 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q92BS0 2.25e-32 124 31 9 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9KC32 3.49e-32 124 29 5 284 3 dapA1 4-hydroxy-tetrahydrodipicolinate synthase 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q71ZN5 3.64e-32 124 31 9 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria monocytogenes serotype 4b (strain F2365)
C1L2Z1 3.64e-32 124 31 9 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8Y766 4.04e-32 123 31 9 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
C6BSH4 6.67e-32 123 29 4 265 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q3ISQ0 9.43e-32 122 30 7 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q67P59 1.03e-31 122 30 5 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A0AIN8 1.64e-31 122 31 9 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B8DE74 1.75e-31 122 31 9 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Listeria monocytogenes serotype 4a (strain HCC23)
C0QT41 4.07e-31 120 28 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Persephonella marina (strain DSM 14350 / EX-H1)
B8GKG7 4.86e-31 120 32 7 258 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
B4U7D7 5.45e-31 120 26 5 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Hydrogenobaculum sp. (strain Y04AAS1)
Q9I4W3 1.63e-30 119 32 5 282 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5FUW9 2.69e-30 119 29 3 248 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Gluconobacter oxydans (strain 621H)
Q60B13 3.72e-30 118 30 6 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1MPX7 8.45e-30 117 29 5 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lawsonia intracellularis (strain PHE/MN1-00)
Q2RJK7 1.14e-29 117 30 5 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q12ZG2 1.14e-29 117 29 5 261 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
B6IN13 2.37e-29 116 32 5 222 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rhodospirillum centenum (strain ATCC 51521 / SW)
A5FZS7 2.69e-29 116 29 6 281 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidiphilium cryptum (strain JF-5)
A4SG05 4.15e-29 115 30 4 278 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q9KA91 4.47e-29 115 30 6 283 3 dapA2 4-hydroxy-tetrahydrodipicolinate synthase 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8MF40 1.12e-28 114 26 8 280 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Alkaliphilus oremlandii (strain OhILAs)
B2V6F1 1.16e-28 114 26 4 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sulfurihydrogenibium sp. (strain YO3AOP1)
Q11JT7 1.55e-28 114 31 2 226 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chelativorans sp. (strain BNC1)
Q04FS1 1.76e-28 114 30 10 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q57695 2.73e-28 113 29 3 258 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A6UVG7 2.73e-28 113 28 4 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q9A900 3.83e-28 113 31 7 266 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A8ET60 5.11e-28 112 26 6 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aliarcobacter butzleri (strain RM4018)
Q8U319 7.17e-28 112 29 4 260 3 dapAL Uncharacterized DapA-like lyase PF0657 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q3A1U7 7.75e-28 112 29 7 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
P58207 8.68e-28 112 30 2 224 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A3DE17 9.54e-28 112 25 4 283 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A9HIW2 9.69e-28 112 30 4 242 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B1GYN1 1.01e-27 112 27 5 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Endomicrobium trichonymphae
A4XSW1 1.02e-27 112 29 5 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudomonas mendocina (strain ymp)
Q3Z7V3 1.57e-27 111 32 4 262 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q0AI27 1.62e-27 111 28 5 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B2A3B2 1.65e-27 111 28 6 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B4RCW4 1.66e-27 111 28 8 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Phenylobacterium zucineum (strain HLK1)
Q8EQJ1 1.72e-27 111 28 7 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q4ZW75 1.93e-27 111 28 5 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudomonas syringae pv. syringae (strain B728a)
Q46DC4 2.4e-27 110 29 6 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q9UZ94 2.52e-27 110 30 5 260 3 dapAL Uncharacterized DapA-like lyase PYRAB12600 Pyrococcus abyssi (strain GE5 / Orsay)
Q48LD5 2.69e-27 110 29 5 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1I383 4.73e-27 110 28 9 298 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Desulforudis audaxviator (strain MP104C)
Q2JQ67 4.82e-27 110 26 6 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain JA-2-3B'a(2-13))
C1DD55 4.85e-27 110 31 4 238 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Laribacter hongkongensis (strain HLHK9)
A5FQT5 5.11e-27 110 31 4 263 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q5F849 5.37e-27 110 31 4 238 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9A656 5.44e-27 110 28 4 257 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
B0K4I3 6.48e-27 110 25 2 255 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermoanaerobacter sp. (strain X514)
B0KAL7 6.48e-27 110 25 2 255 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q2FNR0 6.61e-27 109 29 5 257 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q8TUZ4 7e-27 110 28 8 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q5P838 7.63e-27 109 29 8 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9JUU9 8.21e-27 109 31 4 238 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5V5D4 9.33e-27 109 29 7 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
B3E936 9.5e-27 109 29 9 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q9JZR4 1.04e-26 109 30 4 238 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B4SE03 1.15e-26 109 28 6 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q6MDD9 1.15e-26 109 25 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Protochlamydia amoebophila (strain UWE25)
A6US71 1.26e-26 108 29 4 257 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
A9M4C8 1.28e-26 108 31 4 238 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Neisseria meningitidis serogroup C (strain 053442)
A5VPI5 1.39e-26 108 30 7 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YG60 1.39e-26 108 30 7 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57E96 1.39e-26 108 30 7 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Brucella abortus biovar 1 (strain 9-941)
Q8DJK4 1.42e-26 108 30 8 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q3ZXV3 1.45e-26 108 31 4 262 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Dehalococcoides mccartyi (strain CBDB1)
Q8UGL3 2.46e-26 108 30 3 238 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q39Z67 2.72e-26 108 28 6 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B9M380 3.11e-26 107 27 6 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A6VJM9 3.25e-26 107 28 4 257 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
A1US27 3.76e-26 107 30 3 225 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q2JWL7 3.94e-26 108 28 9 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain JA-3-3Ab)
B2VE56 4.18e-26 107 29 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4FYQ3 4.2e-26 107 28 4 257 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
B3PC19 4.61e-26 107 30 9 254 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Cellvibrio japonicus (strain Ueda107)
B8HYL7 5.45e-26 107 30 10 302 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A1KTJ9 5.89e-26 107 30 4 238 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
B3QM33 5.95e-26 107 28 3 262 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8G1R0 6.5e-26 107 29 7 290 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Brucella suis biovar 1 (strain 1330)
Q2NS74 7.15e-26 107 28 6 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sodalis glossinidius (strain morsitans)
A2SQU8 7.3e-26 107 27 9 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
A1WZ50 8.81e-26 107 29 4 256 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Halorhodospira halophila (strain DSM 244 / SL1)
O67216 9.3e-26 106 26 3 254 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aquifex aeolicus (strain VF5)
Q6AR63 1e-25 106 29 4 251 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q8KC06 1.19e-25 106 29 3 262 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B0SL58 1.35e-25 106 29 4 226 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SCT0 1.35e-25 106 29 4 226 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q82SD7 1.4e-25 106 28 5 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8PXL7 1.53e-25 106 28 6 278 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q3J869 1.58e-25 106 28 5 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q7VXZ8 1.64e-25 106 29 5 258 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q6MRM9 1.75e-25 105 29 8 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B9KI57 1.75e-25 106 28 5 239 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaplasma marginale (strain Florida)
Q5PB64 1.98e-25 105 28 5 239 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaplasma marginale (strain St. Maries)
A4J5V5 2.39e-25 105 27 4 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q8XJ56 2.51e-25 105 29 2 206 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Clostridium perfringens (strain 13 / Type A)
Q21HE7 3.15e-25 105 28 7 283 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2LTA1 3.22e-25 105 30 7 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Syntrophus aciditrophicus (strain SB)
Q9X9W0 3.3e-25 105 26 6 296 3 dapA1 4-hydroxy-tetrahydrodipicolinate synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A9IRK3 4.44e-25 105 31 2 224 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bartonella tribocorum (strain CIP 105476 / IBS 506)
A1K4F8 4.79e-25 104 32 4 214 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Azoarcus sp. (strain BH72)
A1BE04 5.05e-25 104 26 5 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A9KHY6 5.79e-25 104 25 5 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A4VN86 5.94e-25 104 27 5 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Stutzerimonas stutzeri (strain A1501)
B0THT2 6.58e-25 104 28 5 263 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q07607 7e-25 104 29 7 272 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rhizobium meliloti
Q7M7L6 7.47e-25 104 27 8 302 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q0TP55 7.78e-25 104 29 2 206 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q83CA6 8.57e-25 103 27 7 261 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NDT3 8.57e-25 103 27 7 261 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFS0 8.57e-25 103 27 7 261 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Coxiella burnetii (strain Dugway 5J108-111)
B5FGX4 9.8e-25 103 29 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aliivibrio fischeri (strain MJ11)
Q6LZP8 1.05e-24 103 26 3 252 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
B2GC11 1.16e-24 104 30 9 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q5E3I3 1.19e-24 103 29 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A5D2Q5 1.2e-24 103 31 4 227 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q0SRS5 1.23e-24 103 29 2 206 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Clostridium perfringens (strain SM101 / Type A)
B4S5J5 1.25e-24 103 26 4 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q3B2G4 1.31e-24 103 27 4 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q2YVB1 1.36e-24 103 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NYC7 1.51e-24 103 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain MW2)
A8YZD9 1.51e-24 103 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GCF6 1.51e-24 103 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain MSSA476)
Q6GK01 1.51e-24 103 26 6 282 1 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain MRSA252)
A6QDU7 1.51e-24 103 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain Newman)
Q5HJ53 1.51e-24 103 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain COL)
Q2G160 1.51e-24 103 26 6 282 1 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJU9 1.51e-24 103 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain USA300)
Q6G091 1.81e-24 103 30 3 225 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bartonella quintana (strain Toulouse)
Q9HS19 1.81e-24 103 26 6 291 3 dapAL Uncharacterized DapA-like lyase VNG_0444G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R3D6 1.81e-24 103 26 6 291 3 dapAL Uncharacterized DapA-like lyase OE_1665R Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q8THP1 2.08e-24 103 29 7 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q55513 2.09e-24 103 30 11 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q891S3 2.11e-24 103 25 3 258 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Clostridium tetani (strain Massachusetts / E88)
A1ATI8 2.38e-24 102 30 4 225 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q0VRH4 2.46e-24 102 28 4 264 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q8Y099 2.56e-24 102 28 7 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6Q8F8 2.64e-24 102 27 4 262 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sulfurovum sp. (strain NBC37-1)
Q9HJ17 2.82e-24 102 26 9 290 3 dapAL Uncharacterized DapA-like lyase Ta1157 Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
B9MRD1 2.86e-24 102 25 5 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q8RBI5 3.08e-24 102 25 2 255 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A5GD89 3.18e-24 102 26 6 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Geotalea uraniireducens (strain Rf4)
Q3YSK1 3.29e-24 102 25 6 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ehrlichia canis (strain Jake)
A7I0Y0 3.58e-24 102 25 7 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q74GT6 3.86e-24 102 27 6 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
C1F658 4.76e-24 102 28 6 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B2RMB9 5.14e-24 102 28 8 285 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q3APU0 5.21e-24 102 26 5 281 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium chlorochromatii (strain CaD3)
B1JDB7 5.66e-24 102 29 4 259 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudomonas putida (strain W619)
B7IF13 6.58e-24 101 25 4 264 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermosipho africanus (strain TCF52B)
Q2S3M1 7.08e-24 102 27 6 273 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salinibacter ruber (strain DSM 13855 / M31)
B3EMS4 7.89e-24 101 25 4 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium phaeobacteroides (strain BS1)
B8GN57 7.97e-24 101 30 3 229 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
B9DIJ2 8.07e-24 101 25 6 296 3 nanA N-acetylneuraminate lyase Staphylococcus carnosus (strain TM300)
A0B7E1 8.53e-24 101 27 9 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Q2NHW2 9.39e-24 101 25 5 270 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q8F132 9.44e-24 101 30 2 200 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72U22 9.44e-24 101 30 2 200 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q0BYG4 9.8e-24 101 30 2 207 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Hyphomonas neptunium (strain ATCC 15444)
B3EH29 9.81e-24 101 27 5 278 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q9CF61 1.01e-23 101 28 7 265 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lactococcus lactis subsp. lactis (strain IL1403)
Q3SJU8 1.42e-23 100 27 5 286 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thiobacillus denitrificans (strain ATCC 25259)
P99123 1.57e-23 100 26 6 282 1 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain N315)
P63949 1.57e-23 100 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IPI2 1.57e-23 100 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain JH9)
A6TY99 1.57e-23 100 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain JH1)
A7WXZ2 1.57e-23 100 26 6 282 3 nanA N-acetylneuraminate lyase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A2RJL6 2.28e-23 100 28 6 253 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lactococcus lactis subsp. cremoris (strain MG1363)
A4XJU0 2.76e-23 100 25 5 284 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q2Y8S8 3.61e-23 99 29 6 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q47HS9 4.27e-23 99 28 3 231 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Dechloromonas aromatica (strain RCB)
Q03CW3 4.68e-23 99 31 9 300 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3W7E5 4.68e-23 99 31 9 300 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lacticaseibacillus casei (strain BL23)
A8AQB6 4.75e-23 99 25 7 300 3 nanA N-acetylneuraminate lyase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q836D1 4.91e-23 99 28 9 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Enterococcus faecalis (strain ATCC 700802 / V583)
Q32D87 4.93e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q3YZ74 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella sonnei (strain Ss046)
Q31Y13 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella boydii serotype 4 (strain Sb227)
B2TXQ4 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A1U1A6 5.24e-23 99 30 7 239 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B1LNC8 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli (strain SMS-3-5 / SECEC)
B6I548 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli (strain SE11)
P63943 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8A2X1 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O9:H4 (strain HS)
B7MYB7 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O81 (strain ED1a)
B7NQL6 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z015 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P63944 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O157:H7
B7LCL6 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli (strain 55989 / EAEC)
A7ZPS4 5.24e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
P0A6L3 5.63e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella flexneri
P0A6L2 5.63e-23 99 26 4 289 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli (strain K12)
B1IWI1 5.63e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7M7I1 5.63e-23 99 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia coli O8 (strain IAI1)
B5EGX4 5.9e-23 99 28 4 225 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B1Y7F0 6.6e-23 99 29 3 224 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A6Q2V4 7.14e-23 99 27 8 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitratiruptor sp. (strain SB155-2)
A1JL07 8.78e-23 98 28 7 278 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1QTP6 9.59e-23 98 28 4 263 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C4L2D2 1.13e-22 98 28 8 264 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q02XU7 1.17e-22 98 28 6 253 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lactococcus lactis subsp. cremoris (strain SK11)
Q5SJQ1 1.24e-22 98 27 8 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A0LEA7 1.64e-22 97 27 5 276 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
C6E9Q9 1.74e-22 97 28 4 225 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Geobacter sp. (strain M21)
Q7MIL2 1.87e-22 97 26 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Vibrio vulnificus (strain YJ016)
Q92R55 2.16e-22 97 28 3 238 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rhizobium meliloti (strain 1021)
Q058B1 2.37e-22 97 26 4 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A5UAN5 2.48e-22 97 26 4 280 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haemophilus influenzae (strain PittEE)
Q4QNT3 2.51e-22 97 26 4 280 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haemophilus influenzae (strain 86-028NP)
Q72K27 2.52e-22 97 27 8 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A4SX51 2.83e-22 97 29 8 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q9PPB4 2.86e-22 97 26 9 290 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8P9V6 2.87e-22 97 28 4 264 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q5WUD4 2.92e-22 97 28 4 258 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Legionella pneumophila (strain Lens)
Q5ZT51 2.92e-22 97 28 4 258 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A0PZM3 2.97e-22 97 25 7 264 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Clostridium novyi (strain NT)
A5UG62 3.57e-22 97 26 4 280 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haemophilus influenzae (strain PittGG)
Q1RIJ3 3.74e-22 97 29 8 263 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia bellii (strain RML369-C)
Q8DBB0 3.77e-22 97 26 5 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Vibrio vulnificus (strain CMCP6)
Q6LN85 3.91e-22 97 28 3 256 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Photobacterium profundum (strain SS9)
Q4L9T4 5.52e-22 96 25 4 255 3 nanA N-acetylneuraminate lyase Staphylococcus haemolyticus (strain JCSC1435)
P43797 5.52e-22 96 26 4 280 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C1CRD6 5.53e-22 97 27 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae (strain Taiwan19F-14)
A7GYB0 5.55e-22 96 26 7 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter curvus (strain 525.92)
A0LDB5 5.6e-22 96 27 4 243 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q0T239 6.02e-22 96 25 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shigella flexneri serotype 5b (strain 8401)
A8GS25 6.47e-22 96 29 8 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia rickettsii (strain Sheila Smith)
B0BXJ1 6.47e-22 96 29 8 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia rickettsii (strain Iowa)
Q9AKJ9 6.47e-22 96 29 8 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia rickettsii
C5B7A2 6.84e-22 96 28 7 280 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Edwardsiella ictaluri (strain 93-146)
A6L5G7 6.93e-22 96 27 5 271 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q5HUY6 6.97e-22 96 26 9 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter jejuni (strain RM1221)
A1VZF4 6.97e-22 96 26 9 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
B5ELM5 7.17e-22 96 28 4 258 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J6C4 7.17e-22 96 28 4 258 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q92I25 7.31e-22 96 29 8 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A4TMN2 8.04e-22 96 27 8 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Yersinia pestis (strain Pestoides F)
Q8ZCD0 8.04e-22 96 27 8 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Yersinia pestis
A7FG49 8.04e-22 96 27 8 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7VRT1 8.07e-22 96 25 6 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Blochmanniella floridana
A7H443 8.12e-22 96 26 9 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
O26892 8.42e-22 95 26 3 245 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
A1SVX2 9.65e-22 95 27 8 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C4K288 1.1e-21 95 30 5 252 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia peacockii (strain Rustic)
C0R176 1.16e-21 95 23 6 283 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
A6LP58 1.19e-21 95 26 9 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q668F7 1.22e-21 95 27 8 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q2GG09 1.25e-21 95 27 5 262 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
A9NGC2 1.28e-21 95 27 5 255 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acholeplasma laidlawii (strain PG-8A)
C3PNF5 1.3e-21 95 29 8 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia africae (strain ESF-5)
B9KY71 1.32e-21 95 27 5 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q9AKQ3 1.38e-21 95 29 10 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia montanensis
A5IEB3 1.45e-21 95 27 4 258 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Legionella pneumophila (strain Corby)
Q28WG2 1.56e-21 95 28 8 276 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Jannaschia sp. (strain CCS1)
Q15SZ4 1.59e-21 95 26 8 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q8ZN71 1.59e-21 95 26 4 275 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TR62 1.59e-21 95 26 4 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella schwarzengrund (strain CVM19633)
B5BB16 1.59e-21 95 26 4 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PLS1 1.59e-21 95 26 4 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8FLL9 1.62e-21 95 26 10 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A2SIX7 1.62e-21 95 27 7 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A8EYZ4 1.68e-21 95 30 8 253 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia canadensis (strain McKiel)
B7LKG3 1.69e-21 95 26 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B0C142 1.71e-21 95 27 8 268 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acaryochloris marina (strain MBIC 11017)
A8GWS1 1.73e-21 95 27 7 261 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia bellii (strain OSU 85-389)
A8F1K3 1.84e-21 95 29 8 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia massiliae (strain Mtu5)
Q8Z4R8 1.85e-21 95 26 4 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella typhi
B8D8P8 1.86e-21 95 26 4 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B2IPH2 1.93e-21 95 27 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae (strain CGSP14)
Q87AT3 2.3e-21 95 28 4 264 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B6EJT2 2.47e-21 94 29 3 228 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Aliivibrio salmonicida (strain LFI1238)
Q0A5S1 2.48e-21 94 25 5 282 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B8D702 2.54e-21 94 26 4 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57197 2.54e-21 94 26 4 272 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
C1CE08 2.86e-21 95 26 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae (strain JJA)
B8ZPG7 2.86e-21 95 26 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q6GH13 3.56e-21 94 27 4 214 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain MRSA252)
Q7VM87 3.99e-21 94 27 7 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8CMS5 4.45e-21 94 25 5 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A0LZ30 4.77e-21 94 26 6 279 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
B3GZ05 4.99e-21 94 25 6 279 3 nanA N-acetylneuraminate lyase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N352 4.99e-21 94 25 6 279 3 nanA N-acetylneuraminate lyase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BSI2 5.36e-21 94 25 6 279 3 nanA N-acetylneuraminate lyase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q07M65 5.76e-21 94 30 6 265 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rhodopseudomonas palustris (strain BisA53)
A8Z3X3 5.97e-21 93 27 3 199 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain USA300 / TCH1516)
A6QGU6 5.97e-21 93 27 3 199 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain Newman)
Q5HG25 5.97e-21 93 27 3 199 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain COL)
Q9EZ12 5.97e-21 93 27 3 199 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH43 5.97e-21 93 27 3 199 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain USA300)
A4WNS1 6.75e-21 93 27 6 279 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q8NWS5 6.94e-21 93 27 3 199 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain MW2)
Q6G9G6 6.94e-21 93 27 3 199 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain MSSA476)
Q9PER5 7.05e-21 93 28 4 264 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Xylella fastidiosa (strain 9a5c)
Q8PLN5 7.2e-21 93 28 5 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Xanthomonas axonopodis pv. citri (strain 306)
Q4FVD6 8.41e-21 93 31 3 229 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1QL43 9.25e-21 93 30 3 230 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A5WHC3 1.04e-20 93 28 4 249 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Psychrobacter sp. (strain PRwf-1)
B1LGJ0 1.06e-20 93 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli (strain SMS-3-5 / SECEC)
B7NKT6 1.06e-20 93 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LRJ3 1.08e-20 93 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A5F699 1.11e-20 92 25 4 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C1CK93 1.13e-20 93 26 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae (strain P1031)
C1C6Z0 1.13e-20 93 26 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae (strain 70585)
Q1WU86 1.25e-20 92 26 8 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ligilactobacillus salivarius (strain UCC118)
A5FE82 1.35e-20 92 28 2 213 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q8DPZ9 1.4e-20 93 26 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04KR9 1.4e-20 93 26 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q12NF7 1.43e-20 92 25 6 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A0LV15 1.47e-20 92 25 7 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
B0JL91 1.48e-20 92 27 8 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
P63948 1.54e-20 92 26 4 214 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain N315)
P63947 1.54e-20 92 26 4 214 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5ISS7 1.54e-20 92 26 4 214 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain JH9)
A6U1L6 1.54e-20 92 26 4 214 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain JH1)
A7X271 1.54e-20 92 26 4 214 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q31W94 1.72e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Shigella boydii serotype 4 (strain Sb227)
Q8ZLQ6 1.74e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TWJ0 1.74e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella schwarzengrund (strain CVM19633)
Q2G8D6 1.78e-20 92 29 4 231 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q5FKQ9 1.85e-20 92 27 8 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A9MHQ2 1.89e-20 92 25 4 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q2YXX4 1.9e-20 92 26 4 214 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
B0UVZ8 1.93e-20 92 26 6 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Histophilus somni (strain 2336)
Q97GI9 2.08e-20 92 25 4 258 3 dapA1 4-hydroxy-tetrahydrodipicolinate synthase 1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
C0PZN4 2.21e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella paratyphi C (strain RKS4594)
A9N833 2.21e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T750 2.21e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella newport (strain SL254)
B4TJR3 2.21e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella heidelberg (strain SL476)
B5RET7 2.21e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0L2 2.21e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella enteritidis PT4 (strain P125109)
B5FIR8 2.21e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella dublin (strain CT_02021853)
Q57JC9 2.21e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella choleraesuis (strain SC-B67)
Q03K16 2.26e-20 92 25 8 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q3YX23 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Shigella sonnei (strain Ss046)
P0A6L6 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Shigella flexneri
Q0T065 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Shigella flexneri serotype 5b (strain 8401)
Q32BB4 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Shigella dysenteriae serotype 1 (strain Sd197)
B2U1V9 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R6B5 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli (strain UTI89 / UPEC)
P0A6L4 2.28e-20 92 24 7 301 1 nanA N-acetylneuraminate lyase Escherichia coli (strain K12)
B1IQQ4 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TCP1 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGB9 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli O1:K1 / APEC
A8A535 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli O9:H4 (strain HS)
B1XHJ8 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli (strain K12 / DH10B)
C4ZSW3 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0T7 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli O8 (strain IAI1)
B5YSV2 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6L5 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli O157:H7
B7LHT3 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli (strain 55989 / EAEC)
B7MBY7 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJV8 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSB8 2.28e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli O139:H28 (strain E24377A / ETEC)
A4G724 2.34e-20 92 28 6 278 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Herminiimonas arsenicoxydans
Q8FD58 2.35e-20 92 24 7 301 3 nanA1 N-acetylneuraminate lyase 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A5ULF8 2.35e-20 92 25 9 301 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q8Z3F0 2.45e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella typhi
B5BGP5 2.45e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella paratyphi A (strain AKU_12601)
Q5PLE9 2.45e-20 92 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B6I1U3 2.62e-20 92 24 7 301 3 nanA N-acetylneuraminate lyase Escherichia coli (strain SE11)
C3LPG2 2.64e-20 92 25 4 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KQ47 2.64e-20 92 25 4 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A1RKF2 2.77e-20 92 26 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella sp. (strain W3-18-1)
A4Y644 2.77e-20 92 26 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8RQM8 3.14e-20 92 25 7 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8KA24 3.22e-20 91 24 5 281 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8CP96 3.53e-20 91 28 2 187 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q4FLS1 4.17e-20 91 31 2 188 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pelagibacter ubique (strain HTCC1062)
Q97R25 4.34e-20 91 26 8 296 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1IBH4 4.34e-20 91 26 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae (strain Hungary19A-6)
B5E4D5 4.34e-20 91 26 8 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus pneumoniae serotype 19F (strain G54)
A8H415 4.45e-20 91 24 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A8LKQ5 4.56e-20 91 29 3 233 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A3N0Q9 4.61e-20 91 27 8 283 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q5HPE7 4.73e-20 91 27 3 202 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q0HU08 4.82e-20 91 25 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella sp. (strain MR-7)
A1AVV3 5.38e-20 91 30 6 222 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ruthia magnifica subsp. Calyptogena magnifica
Q97D80 5.71e-20 90 22 6 287 3 dapA2 4-hydroxy-tetrahydrodipicolinate synthase 2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B5Z6I0 5.94e-20 91 24 4 263 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain G27)
Q9ZM13 6.19e-20 90 24 6 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q0HHQ6 6.45e-20 90 25 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella sp. (strain MR-4)
A0KVS0 6.45e-20 90 25 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella sp. (strain ANA-3)
Q8YQY1 6.52e-20 90 26 8 295 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A4VU96 6.87e-20 91 26 7 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus suis (strain 05ZYH33)
A4W0I7 6.87e-20 91 26 7 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus suis (strain 98HAH33)
B3GXP5 7.17e-20 90 27 8 283 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A7MP70 7.43e-20 90 24 4 274 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Cronobacter sakazakii (strain ATCC BAA-894)
B4UHY1 7.46e-20 90 28 4 234 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaeromyxobacter sp. (strain K)
Q5MZT3 7.53e-20 90 28 8 265 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31M42 7.53e-20 90 28 8 265 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A9MNY6 8.67e-20 90 23 6 289 3 nanA N-acetylneuraminate lyase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TCA1 9.55e-20 90 25 4 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5F7J9 1.01e-19 90 24 6 282 3 nanA N-acetylneuraminate lyase Salmonella agona (strain SL483)
Q17WU7 1.37e-19 90 23 6 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter acinonychis (strain Sheeba)
B6JL09 1.48e-19 90 24 4 263 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain P12)
Q492F5 1.5e-19 90 25 5 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Blochmanniella pennsylvanica (strain BPEN)
Q1INQ6 1.52e-19 90 27 6 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Koribacter versatilis (strain Ellin345)
B1YJ39 1.58e-19 89 28 3 209 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q8FDU7 1.67e-19 90 24 5 286 3 nanA2 N-acetylneuraminate lyase 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1CU72 1.7e-19 89 25 5 263 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain HPAG1)
Q8EFT7 1.76e-19 89 24 4 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2IGX5 1.79e-19 89 27 4 234 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
C3PH04 2.14e-19 89 27 8 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
B8JAN5 2.23e-19 89 28 2 206 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q11VI2 2.31e-19 89 26 7 289 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A6LA57 2.38e-19 89 27 5 237 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B9KFX0 2.42e-19 89 27 6 222 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q9RH76 2.6e-19 89 30 4 212 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9AKE4 2.71e-19 89 28 9 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
O25657 2.83e-19 89 24 6 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q46ID7 3.19e-19 89 27 8 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain NATL2A)
Q0SWI8 4.48e-19 88 24 7 283 3 nanA N-acetylneuraminate lyase Clostridium perfringens (strain SM101 / Type A)
A6H0M8 4.96e-19 88 27 3 233 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q7VFP9 5.11e-19 88 24 4 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A3CN43 5.15e-19 88 27 6 251 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus sanguinis (strain SK36)
B2USR7 5.7e-19 88 24 5 263 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Helicobacter pylori (strain Shi470)
Q7UZK9 6.04e-19 88 27 10 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q21WN2 6.1e-19 88 28 5 227 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
O86841 7.07e-19 88 25 6 290 3 dapA2 4-hydroxy-tetrahydrodipicolinate synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q0IE16 8.39e-19 87 26 8 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Synechococcus sp. (strain CC9311)
Q49XJ7 9.2e-19 87 26 3 209 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4ULR2 9.44e-19 87 29 9 265 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A0RP26 1.21e-18 87 25 7 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Campylobacter fetus subsp. fetus (strain 82-40)
A1W4S3 1.27e-18 87 28 4 225 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidovorax sp. (strain JS42)
B9MER6 1.27e-18 87 28 4 225 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Acidovorax ebreus (strain TPSY)
B9DP23 1.31e-18 87 24 5 277 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus carnosus (strain TM300)
B2G6M9 1.33e-18 87 28 7 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJ58 1.33e-18 87 28 7 288 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Limosilactobacillus reuteri (strain DSM 20016)
B0UTI7 1.35e-18 87 24 6 274 3 nanA N-acetylneuraminate lyase Histophilus somni (strain 2336)
Q0I2T8 1.35e-18 87 24 6 274 3 nanA N-acetylneuraminate lyase Histophilus somni (strain 129Pt)
P44539 1.39e-18 87 25 6 278 1 nanA N-acetylneuraminate lyase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0BPI4 1.4e-18 87 26 8 283 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q8D2M3 1.43e-18 87 24 8 293 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Wigglesworthia glossinidia brevipalpis
Q4JC35 1.82e-18 86 26 8 246 1 Saci_0225 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q6G468 1.92e-18 86 31 3 225 1 dapA 4-hydroxy-tetrahydrodipicolinate synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q16BK4 2.07e-18 86 27 4 240 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A9FHA5 2.62e-18 86 29 2 210 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sorangium cellulosum (strain So ce56)
Q9S4K9 2.63e-18 86 24 8 281 1 nanA N-acetylneuraminate lyase Clostridium perfringens (strain 13 / Type A)
Q0TUP8 2.63e-18 86 24 8 281 3 nanA N-acetylneuraminate lyase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0I260 2.7e-18 86 24 6 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Histophilus somni (strain 129Pt)
Q89AY0 3.22e-18 86 25 3 215 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B9DS79 3.31e-18 86 28 6 251 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q30R77 3.56e-18 86 26 8 261 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q5QU03 3.62e-18 86 25 6 287 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9L573 4.05e-18 85 25 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella baltica (strain OS195)
A6WPI6 4.05e-18 85 25 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella baltica (strain OS185)
A3D5N2 4.05e-18 85 25 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E724 4.05e-18 85 25 5 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella baltica (strain OS223)
A7HX36 5.08e-18 85 28 3 210 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q4L6A0 5.84e-18 85 25 4 213 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Staphylococcus haemolyticus (strain JCSC1435)
A2BTN4 6.2e-18 85 27 10 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain AS9601)
Q082V3 6.58e-18 85 24 6 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Shewanella frigidimarina (strain NCIMB 400)
B6YQ20 7.04e-18 85 25 3 230 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Azobacteroides pseudotrichonymphae genomovar. CFP2
Q5NPL6 7.41e-18 85 29 3 220 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q5LMK7 8.83e-18 84 26 6 275 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9CLZ7 1.04e-17 84 26 9 283 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Pasteurella multocida (strain Pm70)
Q1GSC8 1.05e-17 84 29 6 254 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B9EBZ6 1.08e-17 84 24 5 261 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Macrococcus caseolyticus (strain JCSC5402)
A6W828 1.08e-17 85 26 7 253 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q6NGP4 1.08e-17 84 25 7 261 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q317Y9 1.12e-17 84 27 10 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain MIT 9312)
A4WF38 1.27e-17 84 25 7 282 3 nanA N-acetylneuraminate lyase Enterobacter sp. (strain 638)
A2BZ39 1.34e-17 84 26 8 292 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain MIT 9515)
O05969 1.62e-17 84 27 11 294 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Rickettsia prowazekii (strain Madrid E)
P59407 1.75e-17 84 23 5 269 1 nanA N-acetylneuraminate lyase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q053P3 1.76e-17 84 30 4 187 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
A8YUT3 1.93e-17 84 26 8 299 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Lactobacillus helveticus (strain DPC 4571)
Q04U80 1.94e-17 84 30 4 187 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A8AXI2 3.01e-17 83 24 8 297 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q73VZ7 3.4e-17 83 26 6 296 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
C5BQD1 3.92e-17 83 28 4 206 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Teredinibacter turnerae (strain ATCC 39867 / T7901)
A3PFE1 4.27e-17 83 27 10 291 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Prochlorococcus marinus (strain MIT 9301)
Q9CKB0 4.58e-17 82 24 5 267 1 nanA N-acetylneuraminate lyase Pasteurella multocida (strain Pm70)
B1MZM8 4.88e-17 82 25 7 290 3 dapA 4-hydroxy-tetrahydrodipicolinate synthase Leuconostoc citreum (strain KM20)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_01525
Feature type CDS
Gene dapA
Product 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase
Location 305126 - 306034 (strand: -1)
Length 909 (nucleotides) / 302 (amino acids)
In genomic island -

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2519
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00701 Dihydrodipicolinate synthetase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0329 Amino acid transport and metabolism (E)
Cell wall/membrane/envelope biogenesis (M)
EM 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K22397 2-dehydro-3-deoxy-D-pentonate aldolase [EC:4.1.2.28] Pentose and glucuronate interconversions
Metabolic pathways
-

Protein Sequence

MNNMGMESRYITPAVTIFDDKGRIDTEQNQQVYDSLKGHVSGFVVMGSTGEFFSLDMESSKTLIRLCGSYDKGGMKVYAGTSRPDVNESAALANYAHEQGVDGVMIISPYYFPLDDEGVYRFYSAVAEKTSANIFIYNFPERTGYSVSPEVCLRLADRYPNIIGLKDTIPDTLHTSQIIQTVKKEIPHFEVYAGYDNNFAHVVLAGGNGCIGGLSNIVPEFFASWMAAFAQGDMAAVAAHQRKVDQLMAVYGVHSPFIPTFKKALQMRGIIQSDYCTAPFSSLNAEQTEQLMQILADAETAR

Flanking regions ( +/- flanking 50bp)

GTTTCATGATTACTTACCTGTGTTTTTATTTATTAACGAGGTTTGTATATATGAACAATATGGGTATGGAAAGCCGTTACATCACGCCGGCTGTAACAATTTTTGATGACAAAGGCCGGATTGATACCGAACAAAACCAGCAGGTGTATGACTCTCTGAAGGGGCATGTCTCCGGATTTGTGGTTATGGGCAGTACCGGCGAGTTTTTTTCACTGGATATGGAAAGCTCAAAAACACTGATCAGGTTATGCGGCAGTTATGACAAAGGGGGAATGAAAGTGTATGCCGGGACCAGCCGCCCGGATGTGAATGAGTCCGCCGCGCTGGCGAACTATGCTCATGAGCAGGGTGTGGACGGGGTCATGATTATCAGCCCGTACTATTTCCCGCTGGATGATGAGGGCGTTTACCGGTTTTACAGCGCGGTCGCGGAAAAAACGTCAGCCAATATTTTTATCTATAACTTCCCGGAACGTACCGGTTACTCGGTGTCACCGGAGGTGTGTCTGCGTCTGGCGGATCGCTATCCGAATATTATCGGGCTGAAAGATACGATCCCCGATACATTACATACGTCGCAGATTATTCAGACGGTAAAAAAAGAGATCCCGCATTTTGAGGTTTATGCCGGTTATGACAATAACTTCGCCCATGTTGTGCTGGCGGGGGGAAATGGCTGTATCGGCGGGTTATCCAATATTGTGCCTGAGTTCTTCGCTTCCTGGATGGCGGCATTTGCACAAGGTGATATGGCTGCCGTAGCGGCACATCAGCGCAAAGTGGATCAGCTGATGGCCGTTTACGGCGTGCACTCACCGTTTATCCCGACCTTTAAAAAAGCATTACAGATGCGGGGCATTATTCAGTCAGACTACTGCACAGCGCCATTCAGCAGCCTGAATGCGGAGCAGACTGAACAGCTGATGCAGATACTGGCGGATGCTGAAACAGCACGCTGATTTTTCCTGATTATAACGACAGAACATCTTACCGACAGGGAATATTATCA