Homologs in group_735

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02355 FBDBKF_02355 55.6 Morganella morganii S1 ydbL DUF1318 domain-containing protein
EHELCC_02825 EHELCC_02825 55.6 Morganella morganii S2 ydbL DUF1318 domain-containing protein
NLDBIP_00635 NLDBIP_00635 55.6 Morganella morganii S4 ydbL DUF1318 domain-containing protein
LHKJJB_01400 LHKJJB_01400 55.6 Morganella morganii S3 ydbL DUF1318 domain-containing protein
HKOGLL_01440 HKOGLL_01440 55.6 Morganella morganii S5 ydbL DUF1318 domain-containing protein
F4V73_RS04735 F4V73_RS04735 54.7 Morganella psychrotolerans - YdbL family protein

Distribution of the homologs in the orthogroup group_735

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_735

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76076 5.43e-33 114 52 1 107 3 ydbL Uncharacterized protein YdbL Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05715
Feature type CDS
Gene -
Product YdbL family protein
Location 1245358 - 1245690 (strand: 1)
Length 333 (nucleotides) / 110 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_735
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07027 Protein of unknown function (DUF1318)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3784 Function unknown (S) S Uncharacterized conserved protein YdbL, DUF1318 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09978 uncharacterized protein - -

Protein Sequence

MNYKKYLFSFALITALISSNAVALTLDEARAQGLVGETFSGYVELVQPNHKQAQILVNEINQARKAKYAEIAKTNQVTPESVARLAGEKLVARANSGEFVKGINGQWIKK

Flanking regions ( +/- flanking 50bp)

GAAGACTTGCTGAAAAACAATAGTGCTATATTCTAACGCTGGGGTGAATAATGAATTATAAAAAATATCTCTTTAGTTTTGCATTAATCACAGCATTGATTAGTTCAAATGCCGTTGCTTTAACACTTGATGAGGCGCGCGCGCAAGGCTTAGTAGGGGAAACTTTTAGTGGTTATGTTGAGTTAGTGCAACCAAACCATAAGCAAGCTCAAATATTGGTGAATGAAATCAATCAAGCCAGAAAAGCCAAATATGCTGAAATTGCTAAAACCAATCAAGTGACTCCTGAATCTGTTGCCCGTTTAGCGGGTGAAAAATTAGTGGCAAGAGCCAATTCAGGTGAGTTTGTTAAAGGAATTAATGGGCAGTGGATTAAGAAATAATATCCACTACCCAAGTAGCGATAAAAGAGAGACTAAATTATTCTCATAGC