Homologs in group_663

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02355 FBDBKF_02355 84.7 Morganella morganii S1 ydbL DUF1318 domain-containing protein
EHELCC_02825 EHELCC_02825 84.7 Morganella morganii S2 ydbL DUF1318 domain-containing protein
NLDBIP_00635 NLDBIP_00635 84.7 Morganella morganii S4 ydbL DUF1318 domain-containing protein
LHKJJB_01400 LHKJJB_01400 84.7 Morganella morganii S3 ydbL DUF1318 domain-containing protein
HKOGLL_01440 HKOGLL_01440 84.7 Morganella morganii S5 ydbL DUF1318 domain-containing protein
PMI_RS05715 PMI_RS05715 54.7 Proteus mirabilis HI4320 - YdbL family protein

Distribution of the homologs in the orthogroup group_663

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_663

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76076 5.77e-27 98 50 1 97 3 ydbL Uncharacterized protein YdbL Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04735
Feature type CDS
Gene -
Product YdbL family protein
Location 1000087 - 1000383 (strand: 1)
Length 297 (nucleotides) / 98 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_663
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07027 Protein of unknown function (DUF1318)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3784 Function unknown (S) S Uncharacterized conserved protein YdbL, DUF1318 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09978 uncharacterized protein - -

Protein Sequence

MVSSSAFALTLDDAKQQGLAGETFSGYIAPVDRAASRDDVKNLVKEINAARSQKYSELAQGNRMKADEVAKIAGQKLVTRAPKGEYVLGINGQWLKKE

Flanking regions ( +/- flanking 50bp)

CATTATTTAAAGCAGGGAAATTCCGTACGGGCGCGGCAGCACTGACTCTGATGGTCAGCAGCTCAGCATTTGCGCTGACACTGGATGACGCAAAGCAACAGGGACTGGCGGGTGAAACCTTCAGCGGCTATATTGCGCCGGTTGACCGTGCGGCCTCACGGGATGATGTCAAAAACCTGGTAAAAGAGATTAATGCCGCCCGATCACAAAAATACAGTGAACTGGCACAGGGCAACCGGATGAAAGCCGATGAAGTGGCAAAAATTGCCGGACAAAAACTGGTTACCCGCGCACCAAAAGGGGAGTATGTCCTTGGCATTAACGGGCAGTGGCTGAAGAAAGAATAGATAATATACAGCAGCAAAACCTCGTAAATAGTCCGCTGCTGTATTAATTC