Homologs in group_711

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02080 FBDBKF_02080 71.4 Morganella morganii S1 znuC zinc ABC transporter ATP-binding protein ZnuC
EHELCC_02550 EHELCC_02550 71.4 Morganella morganii S2 znuC zinc ABC transporter ATP-binding protein ZnuC
NLDBIP_00910 NLDBIP_00910 71.4 Morganella morganii S4 znuC zinc ABC transporter ATP-binding protein ZnuC
LHKJJB_01125 LHKJJB_01125 71.4 Morganella morganii S3 znuC zinc ABC transporter ATP-binding protein ZnuC
HKOGLL_01165 HKOGLL_01165 71.4 Morganella morganii S5 znuC zinc ABC transporter ATP-binding protein ZnuC
F4V73_RS04445 F4V73_RS04445 71.4 Morganella psychrotolerans znuC zinc ABC transporter ATP-binding protein ZnuC

Distribution of the homologs in the orthogroup group_711

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_711

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6D4A8 2.25e-132 376 75 0 237 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7N545 3.2e-131 373 79 0 229 3 znuC Zinc import ATP-binding protein ZnuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q32HA3 1.63e-130 371 75 0 237 3 znuC Zinc import ATP-binding protein ZnuC Shigella dysenteriae serotype 1 (strain Sd197)
Q1CJG3 4.95e-130 370 74 0 239 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CIC2 4.95e-130 370 74 0 239 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q1C812 4.95e-130 370 74 0 239 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
Q66AT7 8.85e-130 369 74 0 239 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q3Z2L6 9.2e-130 369 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Shigella sonnei (strain Ss046)
Q322E8 9.2e-130 369 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Shigella boydii serotype 4 (strain Sb227)
Q1RAS6 9.2e-130 369 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain UTI89 / UPEC)
P0A9X1 9.2e-130 369 74 0 237 1 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain K12)
P0A9X2 9.2e-130 369 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGX4 9.2e-130 369 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC19 9.2e-130 369 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O1:K1 / APEC
P0A9X3 9.2e-130 369 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O157:H7
Q5PIA5 3.62e-129 368 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57NA5 3.62e-129 368 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Salmonella choleraesuis (strain SC-B67)
Q83KR7 7.79e-129 367 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri
Q0T3U8 7.79e-129 367 74 0 237 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri serotype 5b (strain 8401)
A1JRI2 3.78e-128 365 76 0 229 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZNV7 4.03e-128 365 73 0 237 2 znuC Zinc import ATP-binding protein ZnuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5W6 6.82e-128 365 73 0 237 3 znuC Zinc import ATP-binding protein ZnuC Salmonella typhi
Q2NTI7 8.68e-118 339 68 0 237 3 znuC Zinc import ATP-binding protein ZnuC Sodalis glossinidius (strain morsitans)
Q89AJ0 1.03e-94 280 56 1 241 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A0KPH6 4.55e-92 274 60 1 228 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7MMN0 1.52e-91 273 56 0 228 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q8DFQ4 1.52e-91 273 56 0 228 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
Q4KKK4 5.1e-91 271 52 2 257 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q88RL1 1.5e-90 270 58 2 229 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KQB8 2.77e-90 270 57 0 229 3 znuC Zinc import ATP-binding protein ZnuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6LTB1 3.12e-90 269 54 1 255 3 znuC Zinc import ATP-binding protein ZnuC Photobacterium profundum (strain SS9)
Q1MEG2 6.67e-90 270 51 0 232 3 znuC Zinc import ATP-binding protein ZnuC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1IGY7 9.2e-90 268 57 2 229 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas entomophila (strain L48)
Q2K6Q4 1.99e-89 269 52 0 232 3 znuC Zinc import ATP-binding protein ZnuC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q5E6M2 5.76e-89 266 54 0 228 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q3KKA1 5.89e-89 266 57 2 229 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain Pf0-1)
Q4ZZS2 1.96e-88 265 52 3 262 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. syringae (strain B728a)
Q9HT73 6.94e-88 264 57 1 225 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK9 6.94e-88 264 57 1 225 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8K9M6 9.78e-88 262 58 0 234 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q48PV0 4.16e-87 262 56 2 229 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87RE5 4.54e-87 261 54 0 228 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87UN0 9.03e-87 261 56 1 225 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P57403 3.44e-86 258 57 0 228 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8UF79 9.17e-86 259 51 0 232 3 znuC Zinc import ATP-binding protein ZnuC Agrobacterium fabrum (strain C58 / ATCC 33970)
P44692 3.34e-85 257 54 0 225 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q92P76 3.46e-85 258 51 0 232 3 znuC Zinc import ATP-binding protein ZnuC Rhizobium meliloti (strain 1021)
Q4QND5 1.26e-84 255 53 0 225 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus influenzae (strain 86-028NP)
Q576K0 2.09e-83 253 51 0 232 3 znuC Zinc import ATP-binding protein ZnuC Brucella abortus biovar 1 (strain 9-941)
Q2YJH4 2.09e-83 253 51 0 232 3 znuC Zinc import ATP-binding protein ZnuC Brucella abortus (strain 2308)
Q8D385 3.34e-83 251 51 0 232 3 znuC Zinc import ATP-binding protein ZnuC Wigglesworthia glossinidia brevipalpis
Q0VTB6 5.58e-83 251 51 3 255 3 znuC Zinc import ATP-binding protein ZnuC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q8FUU5 8.05e-83 252 51 0 232 3 znuC Zinc import ATP-binding protein ZnuC Brucella suis biovar 1 (strain 1330)
Q65UG3 1.67e-81 247 52 0 225 3 znuC Zinc import ATP-binding protein ZnuC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5LUR8 2e-81 247 50 1 240 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q8YDJ8 3.8e-81 248 50 0 232 3 znuC Zinc import ATP-binding protein ZnuC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q0I4A9 1.08e-80 245 54 0 225 3 znuC Zinc import ATP-binding protein ZnuC Histophilus somni (strain 129Pt)
Q7VLS9 1.58e-80 245 53 0 225 3 znuC Zinc import ATP-binding protein ZnuC Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q21PQ7 2.22e-80 244 51 3 231 3 znuC Zinc import ATP-binding protein ZnuC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q31I51 1.63e-79 242 48 4 250 3 znuC Zinc import ATP-binding protein ZnuC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9CP24 1.41e-78 240 52 0 238 3 znuC Zinc import ATP-binding protein ZnuC Pasteurella multocida (strain Pm70)
Q2SPI3 1.01e-77 238 52 1 225 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Hahella chejuensis (strain KCTC 2396)
Q28VN1 2.53e-77 236 45 0 227 3 znuC Zinc import ATP-binding protein ZnuC Jannaschia sp. (strain CCS1)
A0LCH8 9.08e-77 235 49 0 226 3 znuC Zinc import ATP-binding protein ZnuC Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q1GL85 2.44e-76 234 49 0 226 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria sp. (strain TM1040)
A1U776 3.67e-76 234 53 2 229 3 znuC Zinc import ATP-binding protein ZnuC Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q3IWB5 6.6e-76 233 50 0 226 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A1B9K8 4.21e-74 228 47 2 252 3 znuC Zinc import ATP-binding protein ZnuC Paracoccus denitrificans (strain Pd 1222)
Q11B53 6.62e-74 229 48 0 225 3 znuC Zinc import ATP-binding protein ZnuC Chelativorans sp. (strain BNC1)
Q160Y9 2.43e-73 226 43 0 227 3 znuC Zinc import ATP-binding protein ZnuC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q2W4W1 3.34e-73 226 50 3 236 3 znuC Zinc import ATP-binding protein ZnuC Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q0A9E2 2.43e-70 219 43 1 240 3 znuC Zinc import ATP-binding protein ZnuC Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1R155 2.83e-70 218 44 0 233 3 znuC Zinc import ATP-binding protein ZnuC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2SI12 6.1e-70 217 49 0 236 3 znuC2 Zinc import ATP-binding protein ZnuC 2 Hahella chejuensis (strain KCTC 2396)
A1WXT0 1.27e-69 217 46 2 234 3 znuC Zinc import ATP-binding protein ZnuC Halorhodospira halophila (strain DSM 244 / SL1)
Q6FFL0 7.55e-69 215 47 3 234 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q5E284 1.07e-67 211 48 0 233 3 znuC2 Zinc import ATP-binding protein ZnuC 2 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q4UJW5 8.33e-67 209 43 2 232 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92G36 1.1e-66 209 43 2 232 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q1RGL1 1.34e-65 206 42 2 232 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia bellii (strain RML369-C)
Q68Y13 5.99e-65 204 43 2 232 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZCC4 2.79e-63 200 42 2 232 3 znuC Zinc import ATP-binding protein ZnuC Rickettsia prowazekii (strain Madrid E)
Q1Q889 6.52e-58 187 40 2 232 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FQ27 5.29e-57 184 40 2 232 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q5HBR8 2.32e-52 172 36 1 220 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia ruminantium (strain Welgevonden)
Q5FHB0 2.32e-52 172 36 1 220 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia ruminantium (strain Gardel)
Q3YSK9 4.4e-50 166 36 2 225 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia canis (strain Jake)
Q2GFZ6 8.07e-50 166 36 2 221 3 znuC Zinc import ATP-binding protein ZnuC Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q5PB72 1.32e-47 160 35 1 211 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma marginale (strain St. Maries)
Q2GJA5 3.46e-44 151 34 2 217 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma phagocytophilum (strain HZ)
Q9WXX8 2.06e-42 147 35 2 210 3 TM_0124 Probable metal transport system ATP-binding protein TM_0124 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q73GK9 4.07e-40 141 29 2 224 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia pipientis wMel
Q9XDA6 2.13e-36 132 36 6 224 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q926D8 1.45e-35 129 35 6 224 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5GRS1 6.86e-35 127 28 1 224 3 znuC Zinc import ATP-binding protein ZnuC Wolbachia sp. subsp. Brugia malayi (strain TRS)
P96117 1.84e-32 122 32 7 256 3 troB Zinc transport system ATP-binding protein TroB Treponema pallidum (strain Nichols)
Q2SSS4 2.62e-32 123 31 6 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8ELR4 2.9e-32 124 33 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6MU19 4.8e-32 122 31 6 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q74K65 5.45e-32 123 33 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8Y651 7.4e-32 119 30 4 215 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92AF9 1.51e-31 119 30 4 215 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9PKX1 2.36e-31 119 33 6 230 3 TC_0339 Probable metal transport system ATP-binding protein TC_0339 Chlamydia muridarum (strain MoPn / Nigg)
Q8DZJ0 2.46e-31 121 35 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 2.46e-31 121 35 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 2.46e-31 121 35 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q56953 2.91e-31 119 34 6 241 3 yfeB Chelated iron transport system membrane protein YfeB Yersinia pestis
O84071 3.02e-31 118 32 6 230 3 CT_068 Probable metal transport system ATP-binding protein CT_068 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q042G7 3.98e-31 120 32 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q5XCA4 5.03e-31 120 35 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q7CN92 5.87e-31 120 35 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 5.87e-31 120 35 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
P0CZ35 6.18e-31 120 35 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 6.18e-31 120 35 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 6.18e-31 120 35 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q5L222 6.75e-31 120 32 5 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q1J6Q6 1.01e-30 120 35 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 1.01e-30 120 35 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 1.01e-30 120 35 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 1.01e-30 120 35 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q04G50 2.31e-30 119 32 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q88ZJ6 2.46e-30 118 33 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P44662 2.52e-30 117 31 8 262 3 HI_0361 Probable iron transport system ATP-binding protein HI_0361 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6F0V4 2.64e-30 118 30 5 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q92DL6 2.83e-30 118 32 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AGP9 3.34e-30 118 32 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
O34338 4.62e-30 115 33 6 233 2 mntB Manganese transport system ATP-binding protein MntB Bacillus subtilis (strain 168)
Q830W6 5.28e-30 117 32 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q5FL41 5.87e-30 117 32 8 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q7N8B9 5.92e-30 117 33 6 233 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q81GC1 7.5e-30 116 32 7 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9KD30 1.06e-29 114 32 8 233 3 mntB Manganese transport system ATP-binding protein MntB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A3DDF6 1.08e-29 116 31 4 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q722B1 1.12e-29 117 32 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
Q8DUF7 1.55e-29 117 35 7 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8Y8T6 1.59e-29 116 32 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q5X627 2.24e-29 116 32 5 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q03ZQ0 3e-29 115 31 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q55281 3.32e-29 113 30 5 234 3 mntA Manganese transport system ATP-binding protein MntA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q03AH0 3.88e-29 115 32 8 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q81LM1 4.08e-29 113 32 5 236 1 fpuC Petrobactin import ATP-binding protein FpuC Bacillus anthracis
Q0I2Z4 4.29e-29 115 33 5 233 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
Q8XIZ5 4.48e-29 115 30 4 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 4.48e-29 115 30 4 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A3CMQ7 5.04e-29 115 32 8 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
Q7AH43 5.53e-29 114 33 6 233 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q57293 6.33e-29 114 34 3 208 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
Q14Q07 6.54e-29 114 30 5 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q6HLQ9 6.85e-29 114 31 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q65S66 7.15e-29 114 33 4 232 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q63E84 7.6e-29 114 31 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 7.6e-29 114 31 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 7.6e-29 114 31 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q38VW6 7.96e-29 114 32 6 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q0SRL2 8e-29 114 29 4 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
Q9CM80 8.6e-29 114 35 3 207 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
Q81TH8 1.02e-28 113 31 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
Q9Z8J5 1.76e-28 111 33 4 211 3 CPn_0348 Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 Chlamydia pneumoniae
Q03JH1 2.65e-28 113 33 7 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LYN4 2.68e-28 113 33 7 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q5M397 2.82e-28 113 33 7 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
P37009 3.29e-28 112 34 6 232 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q8DPC2 3.48e-28 113 32 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 3.48e-28 113 32 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 3.48e-28 113 32 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P48334 4.47e-28 110 29 5 234 3 None Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region Cyanophora paradoxa
P44531 5.7e-28 111 34 3 208 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CGD4 5.8e-28 113 32 7 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. lactis (strain IL1403)
Q02Z10 7.31e-28 113 32 7 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. cremoris (strain SK11)
P26050 8.07e-28 110 34 5 224 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O52618 1.15e-27 110 32 6 251 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti (strain 1021)
P55476 1.78e-27 110 37 3 190 3 nodI Nod factor export ATP-binding protein I Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P42360 1.83e-27 108 32 4 234 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
Q7N6Z2 2.61e-27 110 31 6 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A0A0H2ZLL3 2.8e-27 107 30 8 241 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q57554 3.46e-27 107 31 6 234 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q87G35 4.61e-27 112 31 5 230 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 1.93e-11 66 26 6 227 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q668K6 6.76e-27 109 31 8 263 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q2SB47 7.38e-27 107 35 6 229 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
Q8D0W8 9.02e-27 108 31 8 263 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
P72335 1.02e-26 107 32 8 250 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
Q881U6 1.11e-26 106 34 1 182 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8GNH6 1.18e-26 108 32 5 249 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti
Q8KLG1 1.71e-26 107 33 3 207 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8XXY9 2e-26 107 31 5 214 3 nodI Nod factor export ATP-binding protein I Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9CP06 2.83e-26 107 29 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q03PF2 2.92e-26 107 32 7 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A0PY57 2.98e-26 107 30 5 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
P0C0E2 3.05e-26 104 33 4 190 3 srtF Lantibiotic transport ATP-binding protein SrtF Streptococcus pyogenes
P0C0E3 3.05e-26 104 33 4 190 3 srtF Lantibiotic transport ATP-binding protein SrtF Streptococcus pyogenes serotype M1
Q8Z4V6 3.65e-26 107 34 7 235 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
Q1WVI7 4.06e-26 107 31 7 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
P40860 4.59e-26 107 34 6 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P57066 4.65e-26 104 33 6 216 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1M7W6 4.9e-26 106 34 5 218 3 nodI Nod factor export ATP-binding protein I Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P14788 4.92e-26 106 32 5 230 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q30V33 5.84e-26 107 31 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q82TL6 6.48e-26 106 31 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9Z810 6.49e-26 104 35 6 215 3 CPn_0542 Probable metal transport system ATP-binding protein CPn_0542/CP_0210/CPj0542/CpB0563 Chlamydia pneumoniae
Q1GB17 6.71e-26 106 30 7 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q5HQ70 6.9e-26 106 29 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O34946 6.9e-26 103 30 4 210 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
Q8FFB3 7.51e-26 106 33 7 235 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P16676 8.4e-26 106 33 7 235 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q1QE80 8.56e-26 107 31 5 246 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7UC29 8.94e-26 106 32 7 235 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q8XBJ8 9.03e-26 106 33 7 235 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q9KLQ5 9.31e-26 106 31 5 232 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O85818 9.32e-26 106 30 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q6D734 1.11e-25 105 32 6 231 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q39GT7 1.13e-25 105 32 5 217 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q6LKD4 1.17e-25 105 31 5 233 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q04BG2 1.52e-25 105 30 7 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q7VNG4 1.53e-25 105 29 6 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P0A2U7 1.54e-25 103 28 5 225 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U6 1.54e-25 103 28 5 225 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P56344 1.66e-25 103 32 6 232 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q9PJX9 1.85e-25 102 35 6 213 3 TC_0697 Probable metal transport system ATP-binding protein TC_0697 Chlamydia muridarum (strain MoPn / Nigg)
Q1BWI2 1.94e-25 104 32 5 217 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
P94440 1.99e-25 104 32 4 205 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
O34510 2.07e-25 103 32 6 231 3 yfmF Fe(3+)-citrate import ATP-binding protein YfmF Bacillus subtilis (strain 168)
Q97KS6 2.19e-25 105 29 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P45171 2.26e-25 105 29 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0I3Y9 2.69e-25 105 29 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q9Z3I3 2.72e-25 103 34 6 223 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium sp. (strain SNU001)
Q8UA73 3.12e-25 104 34 8 233 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
P74548 3.44e-25 104 33 6 224 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q4QK57 3.62e-25 105 29 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q8U4L3 3.7e-25 102 34 7 218 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P9WQL3 4.36e-25 104 32 5 226 1 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL2 4.36e-25 104 32 5 226 3 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q0AGF4 4.7e-25 104 31 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8CPN0 5.55e-25 104 29 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q7MFH3 5.63e-25 106 30 6 228 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 2.05e-10 63 25 7 229 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q6D201 6.29e-25 103 31 6 236 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P49938 6.43e-25 102 31 6 227 3 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Bacillus subtilis (strain 168)
Q8D3Z9 6.7e-25 105 30 6 228 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 1.23e-10 64 25 7 229 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q92VJ2 8.16e-25 103 30 4 233 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q8PP41 8.77e-25 101 31 3 210 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Xanthomonas axonopodis pv. citri (strain 306)
Q8U4K3 9.68e-25 103 32 6 222 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P08720 9.88e-25 102 34 5 218 3 nodI Nod factor export ATP-binding protein I Rhizobium leguminosarum bv. viciae
Q832R5 1.04e-24 105 32 9 238 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 5.3e-12 68 27 7 211 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q1MQ44 1.1e-24 103 30 4 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
P15031 1.11e-24 101 33 8 226 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
P0C0E9 1.16e-24 102 33 8 229 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 1.16e-24 102 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 1.16e-24 102 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 1.16e-24 102 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 1.16e-24 102 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 1.16e-24 102 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 1.16e-24 102 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 1.16e-24 102 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1LKJ2 1.2e-24 102 30 5 214 3 nodI Nod factor export ATP-binding protein I Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q48QM2 1.23e-24 101 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 1.23e-24 101 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 1.23e-24 101 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q8DIA0 1.31e-24 102 31 6 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q5E586 1.39e-24 103 28 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
P94374 1.67e-24 101 32 7 213 2 yxlF Uncharacterized ABC transporter ATP-binding protein YxlF Bacillus subtilis (strain 168)
Q0S0X2 1.99e-24 100 31 5 233 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Rhodococcus jostii (strain RHA1)
Q72FW5 2.02e-24 102 30 4 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q1J982 2.07e-24 101 33 8 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q4L5B3 2.09e-24 102 28 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
P50332 2.27e-24 102 34 6 220 3 nodI Nod factor export ATP-binding protein I Neorhizobium galegae
Q48IB9 2.3e-24 100 32 1 182 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q6LQ00 2.39e-24 104 31 5 214 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 1.05e-09 61 28 9 219 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q8RGC8 2.47e-24 102 28 7 238 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9K876 2.81e-24 102 32 7 231 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8A883 2.82e-24 103 29 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q18AM3 2.99e-24 102 28 5 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q5QU46 3.01e-24 99 33 6 209 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q9HYG4 3.34e-24 100 34 4 201 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O69063 3.37e-24 101 31 7 240 3 htxD Hypophosphite import ATP-binding protein HtxD Stutzerimonas stutzeri
Q07LU3 3.59e-24 100 30 6 231 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q2NHA1 4.21e-24 100 33 7 216 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q7MFC4 4.28e-24 102 30 5 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio vulnificus (strain YJ016)
Q8D3V0 4.28e-24 102 30 5 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio vulnificus (strain CMCP6)
Q39GW5 4.34e-24 101 34 5 204 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q64SQ6 4.95e-24 102 29 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q1B8V9 5.04e-24 102 30 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain MCS)
A1UG51 5.04e-24 102 30 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain KMS)
Q5LBT4 5.05e-24 102 29 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q9YGA6 5.09e-24 101 28 6 245 1 malK Trehalose/maltose import ATP-binding protein MalK Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q9KS33 6.16e-24 101 27 5 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q58429 6.46e-24 99 32 6 201 3 MJ1023 Uncharacterized ABC transporter ATP-binding protein MJ1023 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8EEV5 6.56e-24 98 33 9 224 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9I6L0 6.65e-24 100 30 8 249 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q73F67 7.11e-24 99 32 8 231 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
P0A193 7.46e-24 99 29 7 247 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A194 7.46e-24 99 29 7 247 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Salmonella typhi
Q5WBL0 9.17e-24 99 31 3 204 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q8F6Z1 9.92e-24 100 28 5 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 9.92e-24 100 28 5 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q6HPN0 1e-23 99 32 8 231 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 1e-23 99 32 8 231 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 1e-23 99 32 8 231 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q9KL04 1.02e-23 100 29 5 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8TYV9 1.08e-23 99 30 4 225 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q9KUI0 1.18e-23 100 30 3 226 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q65UE1 1.22e-23 100 29 6 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q92XW1 1.37e-23 100 32 8 230 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q7NX01 1.5e-23 100 30 5 241 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0BUR6 1.52e-23 97 35 5 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q0BFQ0 1.55e-23 99 34 4 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8RD07 1.62e-23 98 30 6 230 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q5JEB0 1.65e-23 99 31 6 221 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q92N13 1.65e-23 98 29 6 244 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
P96605 1.66e-23 99 31 3 204 3 ydbJ Uncharacterized ABC transporter ATP-binding protein YdbJ Bacillus subtilis (strain 168)
Q58488 1.71e-23 99 35 7 219 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9JUX4 1.72e-23 100 29 5 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q1BWL4 1.74e-23 99 34 4 202 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia orbicola (strain AU 1054)
A0K739 1.74e-23 99 34 4 202 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia cenocepacia (strain HI2424)
Q93SH7 1.83e-23 98 29 4 226 3 hmuV Hemin import ATP-binding protein HmuV Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A1TAI4 1.83e-23 100 27 3 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8RI39 1.91e-23 100 30 7 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q02QT1 1.94e-23 98 34 4 201 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q48CA0 1.96e-23 98 32 3 197 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8RCU0 2.02e-23 97 35 6 205 3 pstB1 Phosphate import ATP-binding protein PstB 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q665B6 2.12e-23 98 33 3 199 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q9V2E4 2.13e-23 98 33 8 218 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q87GB5 2.15e-23 100 29 5 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q04EY4 2.22e-23 98 29 9 241 3 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q57399 2.31e-23 97 28 5 241 1 molC Molybdate import ATP-binding protein MolC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3JSQ0 2.35e-23 99 32 3 190 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 2.35e-23 99 32 3 190 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
O07016 2.36e-23 99 29 6 218 3 yvfR Uncharacterized ABC transporter ATP-binding protein YvfR Bacillus subtilis (strain 168)
Q6LR20 2.47e-23 100 29 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q63TX3 2.47e-23 99 32 3 190 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
O57872 2.49e-23 97 32 7 219 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q44613 2.91e-23 97 34 4 185 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q4ZLS1 3.16e-23 97 33 3 191 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. syringae (strain B728a)
Q7NIW1 3.16e-23 99 31 6 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q63TW1 3.17e-23 99 34 5 204 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain K96243)
Q8Z0H0 3.17e-23 99 31 6 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q57S53 3.2e-23 99 30 7 235 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q8D653 3.7e-23 99 31 7 232 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
Q8N139 4.03e-23 101 33 6 194 1 ABCA6 ATP-binding cassette sub-family A member 6 Homo sapiens
Q8N139 4.91e-10 62 27 9 229 1 ABCA6 ATP-binding cassette sub-family A member 6 Homo sapiens
Q2YAD6 4.22e-23 99 31 6 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q87PH3 4.47e-23 99 27 6 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q62K56 4.62e-23 98 34 5 204 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia mallei (strain ATCC 23344)
Q8ZR89 4.86e-23 98 30 5 214 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6D2F6 4.93e-23 98 31 5 234 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q035B2 5.35e-23 97 30 6 230 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q3JSR6 5.44e-23 98 34 5 204 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain 1710b)
Q50801 5.47e-23 97 33 8 225 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q8Z8R5 6.08e-23 98 30 4 213 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q0TJC1 6.2e-23 96 34 5 211 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q13ZK7 6.25e-23 98 32 2 195 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Paraburkholderia xenovorans (strain LB400)
Q66FK0 6.66e-23 97 30 8 236 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CE65 6.66e-23 97 30 8 236 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Nepal516)
Q56993 6.66e-23 97 30 8 236 1 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis
Q1C0Q8 6.66e-23 97 30 8 236 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Antiqua)
Q87UI3 6.95e-23 97 33 3 191 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7A169 7.15e-23 98 30 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MW2)
Q6GAB5 7.15e-23 98 30 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MSSA476)
Q6GHY6 7.15e-23 98 30 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MRSA252)
Q7A679 7.15e-23 98 30 5 235 1 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain N315)
Q99V03 7.15e-23 98 30 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGY5 7.15e-23 98 30 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain COL)
Q2YX74 7.15e-23 98 30 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2A7 7.15e-23 98 30 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHY1 7.15e-23 98 30 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain USA300)
Q8T674 7.41e-23 100 31 6 219 3 abcG20 ABC transporter G family member 20 Dictyostelium discoideum
Q9CN78 7.46e-23 95 32 4 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pasteurella multocida (strain Pm70)
Q65QT6 7.75e-23 98 30 6 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8KZQ6 7.79e-23 96 32 5 214 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida
Q58283 8.7e-23 97 27 6 233 3 MJ0873 Uncharacterized ABC transporter ATP-binding protein MJ0873 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q88R93 9.1e-23 96 32 4 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1CDR0 9.27e-23 96 32 3 199 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 9.27e-23 96 32 3 199 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 9.27e-23 96 32 3 199 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q63H62 9.7e-23 96 32 8 231 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q9JZW0 1.01e-22 98 29 5 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8E8K8 1.01e-22 98 30 8 234 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C0SPB4 1.22e-22 97 31 6 230 3 yhaQ Uncharacterized ABC transporter ATP-binding protein YhaQ Bacillus subtilis (strain 168)
Q81J16 1.28e-22 96 30 8 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8DRR9 1.32e-22 96 31 8 227 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2SVP3 1.37e-22 96 32 3 190 3 nodI Nod factor export ATP-binding protein I Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
O34362 1.37e-22 99 30 5 216 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 5.9e-12 68 27 5 214 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q1RDS4 1.38e-22 95 33 5 211 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain UTI89 / UPEC)
A1A9L0 1.38e-22 95 33 5 211 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O1:K1 / APEC
Q664X5 1.46e-22 97 31 6 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CNR8 1.46e-22 97 31 6 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAS8 1.46e-22 97 31 6 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis
Q1CC21 1.46e-22 97 31 6 230 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis bv. Antiqua (strain Antiqua)
Q62K82 1.51e-22 97 30 6 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q9FJH6 1.52e-22 99 30 6 210 2 ABCF1 ABC transporter F family member 1 Arabidopsis thaliana
Q63TY1 1.53e-22 97 30 6 240 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q21XJ9 1.54e-22 96 29 3 224 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
P23703 1.66e-22 97 28 6 249 3 nodI Nod factor export ATP-binding protein I Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q7NTU0 1.69e-22 95 31 7 231 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P27675 1.98e-22 95 31 9 241 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q8NR42 2.11e-22 95 33 7 227 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q4KC87 2.19e-22 97 29 4 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q7NRX5 2.19e-22 97 32 9 237 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2SVN0 2.22e-22 96 34 7 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q87R20 2.24e-22 94 32 5 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O84421 2.28e-22 94 34 6 213 3 CT_416 Probable metal transport system ATP-binding protein CT_416 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q7MKU3 2.31e-22 97 26 5 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 2.31e-22 97 26 5 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q3KCC5 2.38e-22 97 30 7 227 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain Pf0-1)
Q5PCG9 2.38e-22 96 30 5 214 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q49WM4 2.43e-22 97 28 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9HY19 2.45e-22 97 31 7 232 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q93DX8 2.56e-22 95 28 5 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q6LPK2 2.65e-22 94 34 5 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photobacterium profundum (strain SS9)
Q02R79 2.69e-22 97 31 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q660M8 2.7e-22 96 30 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q1GJU0 2.77e-22 95 33 10 230 3 hmuV Hemin import ATP-binding protein HmuV Ruegeria sp. (strain TM1040)
Q609Q1 2.84e-22 96 30 5 238 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9V2C0 2.88e-22 96 31 7 237 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus abyssi (strain GE5 / Orsay)
Q0HVQ0 3.03e-22 94 31 6 222 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-7)
Q0SML1 3.11e-22 96 29 5 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q6FAN3 3.13e-22 96 32 6 215 3 metN1 Methionine import ATP-binding protein MetN 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1MFL8 3.21e-22 95 31 2 201 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
O51587 3.24e-22 96 30 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q897I2 3.28e-22 97 31 4 199 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 6.64e-07 53 28 3 124 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q8EBC3 3.35e-22 97 28 5 256 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q4K441 3.87e-22 95 32 3 194 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6LK87 3.96e-22 96 28 6 232 3 malK Maltose/maltodextrin import ATP-binding protein MalK Photobacterium profundum (strain SS9)
Q1GIE5 4.17e-22 96 28 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
Q5NN23 4.53e-22 94 32 3 200 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q32EY4 4.62e-22 96 28 6 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
Q38UU0 4.79e-22 95 32 10 244 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Latilactobacillus sakei subsp. sakei (strain 23K)
O31427 4.83e-22 94 32 5 187 1 skfE SkfA peptide export ATP-binding protein SkfE Bacillus subtilis (strain 168)
P0A9S9 4.96e-22 94 27 6 247 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Shigella flexneri
P0A9S7 4.96e-22 94 27 6 247 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli (strain K12)
P0A9S8 4.96e-22 94 27 6 247 3 livG High-affinity branched-chain amino acid transport ATP-binding protein LivG Escherichia coli O157:H7
Q9HYF9 5.07e-22 94 31 3 211 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QT6 5.07e-22 94 31 3 211 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1WSB9 5.09e-22 95 30 8 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
P39456 5.65e-22 94 29 7 236 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
P63389 5.9e-22 97 33 3 192 1 yheS Probable ATP-binding protein YheS Escherichia coli (strain K12)
P63389 1.5e-09 61 22 7 266 1 yheS Probable ATP-binding protein YheS Escherichia coli (strain K12)
P63390 5.9e-22 97 33 3 192 3 yheS Probable ATP-binding protein YheS Escherichia coli O157:H7
P63390 1.5e-09 61 22 7 266 3 yheS Probable ATP-binding protein YheS Escherichia coli O157:H7
Q9A7X1 5.96e-22 95 31 7 236 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P33982 6.14e-22 94 26 6 223 3 AZC_3926 Probable ABC transporter ATP-binding protein AZC_3926 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q7NQN5 6.2e-22 95 30 7 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0HJG0 6.43e-22 93 30 7 225 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shewanella sp. (strain MR-4)
Q6D4E2 6.5e-22 96 29 6 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A0A0H2VBH0 6.62e-22 97 33 3 192 1 yheS Probable ATP-binding protein YheS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A0A0H2VBH0 1.45e-09 61 22 7 266 1 yheS Probable ATP-binding protein YheS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9KL34 7.3e-22 94 31 7 227 3 hmuV Hemin import ATP-binding protein HmuV Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q0I3C2 7.3e-22 93 32 5 192 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Histophilus somni (strain 129Pt)
Q9G4F5 7.4e-22 95 29 5 238 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
O31339 7.47e-22 95 29 6 229 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8XZP8 7.87e-22 95 30 5 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q58762 8.2e-22 94 32 7 211 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P69877 8.62e-22 95 28 6 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 8.62e-22 95 28 6 239 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 8.62e-22 95 28 6 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 8.62e-22 95 28 6 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 8.62e-22 95 28 6 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q5DZC6 8.87e-22 95 28 6 232 3 malK Maltose/maltodextrin import ATP-binding protein MalK Aliivibrio fischeri (strain ATCC 700601 / ES114)
P63354 9.35e-22 95 29 5 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 9.35e-22 95 29 5 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P40790 9.62e-22 95 29 7 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PMK1 9.62e-22 95 29 7 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57QC8 9.62e-22 95 29 7 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
Q9MUN1 9.69e-22 95 31 4 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q1RD28 9.92e-22 95 28 6 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 9.92e-22 95 28 6 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
Q0SK28 1.02e-21 93 31 3 198 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Rhodococcus jostii (strain RHA1)
Q5E0B3 1.07e-21 93 32 5 205 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q97UY8 1.07e-21 95 30 5 232 1 glcV Glucose import ATP-binding protein GlcV Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P45092 1.09e-21 93 31 6 228 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8Z7H7 1.14e-21 95 29 7 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q3Z2Z3 1.26e-21 95 28 6 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 1.26e-21 95 28 6 239 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q65T42 1.36e-21 95 29 5 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P21410 1.47e-21 94 30 4 217 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Serratia marcescens
Q0T5R2 1.53e-21 95 27 8 269 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
Q7N3A6 1.54e-21 92 31 3 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P55662 1.65e-21 93 28 7 246 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8K441 1.71e-21 96 32 6 201 1 Abca6 ATP-binding cassette sub-family A member 6 Mus musculus
Q8K441 1.87e-09 61 23 8 230 1 Abca6 ATP-binding cassette sub-family A member 6 Mus musculus
Q6F9A8 1.72e-21 94 30 5 230 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6D664 1.76e-21 92 31 4 189 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q1LQF6 1.77e-21 94 31 3 208 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q13ZJ1 1.79e-21 94 33 3 190 3 nodI Nod factor export ATP-binding protein I Paraburkholderia xenovorans (strain LB400)
O26236 1.82e-21 93 31 6 210 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8UCD5 1.84e-21 94 30 5 222 3 modC Molybdenum import ATP-binding protein ModC Agrobacterium fabrum (strain C58 / ATCC 33970)
P54592 1.86e-21 94 31 2 191 3 yhcH Uncharacterized ABC transporter ATP-binding protein YhcH Bacillus subtilis (strain 168)
Q1IGL4 1.87e-21 93 31 3 191 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas entomophila (strain L48)
Q88AS5 1.93e-21 94 29 6 234 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4FMG5 1.94e-21 92 32 5 199 3 tauB Taurine import ATP-binding protein TauB Pelagibacter ubique (strain HTCC1062)
Q9X196 1.98e-21 94 28 4 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q7VZE5 2.04e-21 94 28 5 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q88XV1 2.09e-21 93 29 7 242 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q3YUV0 2.21e-21 94 28 6 232 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella sonnei (strain Ss046)
Q1R3Q1 2.21e-21 94 28 6 232 1 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli (strain UTI89 / UPEC)
P68187 2.21e-21 94 28 6 232 1 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli (strain K12)
P68188 2.21e-21 94 28 6 232 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O157:H7
Q8FB37 2.3e-21 94 28 6 232 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7CS28 2.34e-21 94 26 4 253 1 smoE Sulfoquinovosyl glycerol transport ATP-binding protein SmoE Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8DWR3 2.34e-21 93 33 7 206 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 2.34e-21 93 33 7 206 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 2.34e-21 93 33 7 206 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3K506 2.41e-21 92 32 3 191 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas fluorescens (strain Pf0-1)
Q7UBD0 2.42e-21 94 28 6 232 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella flexneri
Q8U3E0 2.78e-21 92 29 5 206 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q12R52 2.9e-21 92 28 4 232 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8FJ95 2.99e-21 92 33 5 211 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05555
Feature type CDS
Gene znuC
Product zinc ABC transporter ATP-binding protein ZnuC
Location 1211448 - 1212173 (strand: -1)
Length 726 (nucleotides) / 241 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_711
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1121 Inorganic ion transport and metabolism (P) P ABC-type Mn2+/Zn2+ transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09817 zinc transport system ATP-binding protein [EC:7.2.2.20] ABC transporters -

Protein Sequence

MSDLIRLKSVGVSFGESVILKDISFNLKAGRILTLLGPNGAGKSTIIRLVLGLLAPSSGKIERQHSLRIGYVPQKLYLDPTMPLTVKRFMTLKPGVKDKDILPALERVNAAKLINAPMQKLSGGESQRVLLARALLNQPQLLVLDEPTQGVDVNGQLALYDLINQLRNELGCAILMVSHDLHLVMAKTDEVLCLNGHICCSGTPDVVSSHPEFIAMFGSRGAEQLGIYRHHHQHNKECHHD

Flanking regions ( +/- flanking 50bp)

TTGGAAATGTTATATTATAACGTTTCAATGATTCTGCAAGTGCTAATTTTATGTCTGACTTAATTCGTTTAAAATCGGTTGGTGTCTCTTTTGGTGAAAGCGTTATTCTAAAAGATATCTCTTTTAATCTAAAAGCAGGCCGTATTCTTACCTTACTTGGCCCTAATGGTGCGGGTAAGTCAACGATTATTCGTTTGGTTTTAGGGTTGTTGGCTCCCTCTTCTGGAAAGATTGAACGTCAACATAGTTTACGTATTGGCTATGTACCTCAAAAACTCTATCTCGATCCAACTATGCCATTGACAGTCAAGCGGTTTATGACCTTAAAACCGGGTGTTAAAGATAAAGATATTTTACCTGCTTTAGAACGAGTCAATGCAGCAAAATTAATAAACGCCCCTATGCAAAAATTATCAGGGGGTGAATCACAACGTGTTTTACTCGCCCGAGCTTTACTTAATCAACCACAACTGTTAGTTCTAGATGAACCCACTCAAGGGGTTGATGTAAATGGTCAATTAGCCCTCTATGATTTAATTAATCAGCTTCGCAATGAATTAGGCTGCGCAATTTTAATGGTGTCACATGACTTACATCTGGTTATGGCTAAAACAGATGAAGTGCTCTGTTTAAATGGTCATATCTGCTGCTCAGGTACACCAGATGTGGTTTCTTCTCACCCTGAATTTATAGCTATGTTTGGTAGTCGTGGTGCTGAACAACTGGGTATTTATCGTCATCATCACCAACATAATAAGGAGTGTCATCATGATTGAGTTGCTGTTACCGGGCTGGATCGCCGGTATGCTCTTAGCGATGGCCGCAG