Homologs in group_1940

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14560 FBDBKF_14560 87.5 Morganella morganii S1 mnmA tRNA 2-thiouridine(34) synthase MnmA
EHELCC_15365 EHELCC_15365 87.5 Morganella morganii S2 mnmA tRNA 2-thiouridine(34) synthase MnmA
NLDBIP_15895 NLDBIP_15895 87.5 Morganella morganii S4 mnmA tRNA 2-thiouridine(34) synthase MnmA
LHKJJB_15945 LHKJJB_15945 87.5 Morganella morganii S3 mnmA tRNA 2-thiouridine(34) synthase MnmA
HKOGLL_15065 HKOGLL_15065 87.5 Morganella morganii S5 mnmA tRNA 2-thiouridine(34) synthase MnmA
F4V73_RS07355 F4V73_RS07355 87.2 Morganella psychrotolerans mnmA tRNA 2-thiouridine(34) synthase MnmA

Distribution of the homologs in the orthogroup group_1940

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1940

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EVG2 0.0 765 100 0 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Proteus mirabilis (strain HI4320)
A8GDD5 0.0 687 86 0 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Serratia proteamaculans (strain 568)
Q7MB22 0.0 685 86 0 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JLK6 0.0 680 87 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JI67 0.0 674 85 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Q4 0.0 674 85 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TLN3 0.0 674 85 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Yersinia pestis (strain Pestoides F)
Q1CI58 0.0 674 85 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0L5 0.0 674 85 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFQ5 0.0 674 85 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Yersinia pestis
B2K711 0.0 674 85 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C6S0 0.0 674 85 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Yersinia pestis bv. Antiqua (strain Antiqua)
C5B8B9 0.0 674 86 0 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Edwardsiella ictaluri (strain 93-146)
A7FH61 0.0 673 85 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DFW7 0.0 673 86 1 368 3 mnmA tRNA-specific 2-thiouridylase MnmA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4E9 0.0 669 85 1 368 3 mnmA tRNA-specific 2-thiouridylase MnmA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MFV2 0.0 668 86 0 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Cronobacter sakazakii (strain ATCC BAA-894)
A6T7K3 0.0 647 87 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSN3 0.0 646 87 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Klebsiella pneumoniae (strain 342)
A4W9E5 0.0 636 85 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Enterobacter sp. (strain 638)
B1LI10 0.0 633 85 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli (strain SMS-3-5 / SECEC)
Q8X735 0.0 633 85 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli O157:H7
P25745 0.0 632 84 1 365 1 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli (strain K12)
B1IUD4 0.0 632 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZ88 0.0 632 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli O9:H4 (strain HS)
B1XA43 0.0 632 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli (strain K12 / DH10B)
A7ZKS3 0.0 632 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32EZ1 0.0 631 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Shigella dysenteriae serotype 1 (strain Sd197)
Q31ZK9 0.0 631 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Shigella boydii serotype 4 (strain Sb227)
B2TZ86 0.0 631 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3Z2Y6 0.0 631 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Shigella sonnei (strain Ss046)
Q83LF7 0.0 631 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Shigella flexneri
Q0T5N9 0.0 631 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Shigella flexneri serotype 5b (strain 8401)
Q1RD20 0.0 631 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli (strain UTI89 / UPEC)
Q0TIU0 0.0 631 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AA27 0.0 631 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli O1:K1 / APEC
Q8Z7G9 0.0 630 85 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Salmonella typhi
A9N4K8 0.0 630 85 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PMJ4 0.0 630 85 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57QC0 0.0 629 85 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Salmonella choleraesuis (strain SC-B67)
Q8ZPZ4 0.0 629 85 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MG80 0.0 626 85 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AHK2 0.0 626 84 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8CXZ8 0.0 625 84 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
C4L952 0.0 612 80 0 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q2NU15 0.0 609 77 0 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Sodalis glossinidius (strain morsitans)
A4SKS0 0.0 600 78 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Aeromonas salmonicida (strain A449)
A1STI9 0.0 600 77 0 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A0KI53 0.0 599 78 1 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q9KSX8 0.0 593 77 1 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2F2 0.0 593 77 1 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q5QYZ7 0.0 592 77 0 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0I5Y6 0.0 591 75 0 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Histophilus somni (strain 129Pt)
B0UWF2 0.0 589 75 0 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Histophilus somni (strain 2336)
A1S7B1 0.0 587 75 0 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q6LT18 0.0 585 77 4 371 3 mnmA tRNA-specific 2-thiouridylase MnmA Photobacterium profundum (strain SS9)
Q7U342 0.0 585 74 0 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4QP16 0.0 583 78 0 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Haemophilus influenzae (strain 86-028NP)
Q9CLA3 0.0 582 76 0 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Pasteurella multocida (strain Pm70)
P44551 0.0 582 78 0 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7MLT4 0.0 582 75 2 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Vibrio vulnificus (strain YJ016)
Q8CWJ6 0.0 578 74 2 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Vibrio vulnificus (strain CMCP6)
A7MSW1 0.0 577 75 2 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Vibrio campbellii (strain ATCC BAA-1116)
Q87QL9 0.0 577 75 2 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0BS63 0.0 575 76 0 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B8CLH4 0.0 574 75 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella piezotolerans (strain WP3 / JCM 13877)
A3MYN0 0.0 574 76 0 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0HJT7 0.0 570 73 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella sp. (strain MR-4)
A3QD79 0.0 570 74 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8CX40 0.0 568 73 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HW33 0.0 568 73 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella sp. (strain MR-7)
A5UFX6 0.0 568 77 1 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Haemophilus influenzae (strain PittGG)
B0TQ02 0.0 567 74 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella halifaxensis (strain HAW-EB4)
A0KW11 0.0 566 73 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella sp. (strain ANA-3)
Q15T93 0.0 566 72 0 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A8H5M1 0.0 564 73 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B5FG83 0.0 563 73 3 374 3 mnmA tRNA-specific 2-thiouridylase MnmA Aliivibrio fischeri (strain MJ11)
Q5E3W7 0.0 563 73 3 374 3 mnmA tRNA-specific 2-thiouridylase MnmA Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4Y7M1 0.0 562 73 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9L4G9 0.0 562 73 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella baltica (strain OS195)
A6WP69 0.0 561 73 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella baltica (strain OS185)
A3D5F8 0.0 561 73 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E945 0.0 561 73 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella baltica (strain OS223)
A8FUG9 0.0 560 73 0 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella sediminis (strain HAW-EB3)
A1RIW8 0.0 559 73 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella sp. (strain W3-18-1)
Q081F9 0.0 558 73 1 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella frigidimarina (strain NCIMB 400)
B1KID0 0.0 555 72 0 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella woodyi (strain ATCC 51908 / MS32)
Q65VV2 0.0 554 76 0 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q12N64 0.0 553 73 1 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q1LT51 0.0 553 70 0 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3IH16 0.0 552 72 0 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudoalteromonas translucida (strain TAC 125)
Q480B8 0.0 548 70 1 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A6VLY4 0.0 542 74 0 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C3JY68 0.0 530 70 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas fluorescens (strain SBW25)
Q4ZRK0 0.0 527 70 2 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas syringae pv. syringae (strain B728a)
Q3KA70 0.0 525 69 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas fluorescens (strain Pf0-1)
A4XUY9 0.0 525 68 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas mendocina (strain ymp)
Q48H61 0.0 525 69 2 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4K9U2 0.0 524 69 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q87ZR6 0.0 521 68 2 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A4VLW2 0.0 519 68 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Stutzerimonas stutzeri (strain A1501)
Q492R5 0.0 517 65 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Blochmanniella pennsylvanica (strain BPEN)
A6V4G0 0.0 514 68 2 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas aeruginosa (strain PA7)
Q1IBE4 0.0 513 67 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas entomophila (strain L48)
B1JBJ1 0.0 513 67 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas putida (strain W619)
B7UV15 0.0 511 68 2 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas aeruginosa (strain LESB58)
Q9I0L2 0.0 510 68 2 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NB8 0.0 510 68 2 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q88FR9 0.0 509 67 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KMQ6 1.05e-180 508 67 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas putida (strain GB-1)
A5W1G2 1.2e-180 508 67 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A1U1H5 4.48e-179 505 67 3 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A6W0E1 4.86e-179 505 67 1 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Marinomonas sp. (strain MWYL1)
Q607H5 3.63e-173 489 64 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5WE20 1.29e-171 486 66 4 372 3 mnmA tRNA-specific 2-thiouridylase MnmA Psychrobacter sp. (strain PRwf-1)
Q1QUR7 1.78e-170 483 65 1 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1QBM4 1.76e-168 479 66 5 376 3 mnmA tRNA-specific 2-thiouridylase MnmA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FSB4 5.56e-167 475 65 5 376 3 mnmA tRNA-specific 2-thiouridylase MnmA Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B0VBY5 7.18e-167 473 66 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Acinetobacter baumannii (strain AYE)
A3M7G3 7.18e-167 473 66 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B7I4K8 7.18e-167 473 66 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Acinetobacter baumannii (strain AB0057)
B7GZ21 7.18e-167 473 66 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Acinetobacter baumannii (strain AB307-0294)
B0VUD6 2.24e-166 472 66 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Acinetobacter baumannii (strain SDF)
Q2SJL8 8.04e-166 470 63 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Hahella chejuensis (strain KCTC 2396)
B2HVN5 8.22e-166 471 66 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Acinetobacter baumannii (strain ACICU)
Q6FCW2 1.13e-165 471 66 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0TW32 1.74e-165 469 62 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A0Q454 2.17e-165 469 63 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Francisella tularensis subsp. novicida (strain U112)
Q5NEF9 7.31e-165 468 63 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
B2SEJ7 7.31e-165 468 63 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14FW2 7.31e-165 468 63 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Francisella tularensis subsp. tularensis (strain FSC 198)
A4J081 3.69e-164 466 62 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BP64 3.77e-164 466 62 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5X5 3.77e-164 466 62 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Francisella tularensis subsp. holarctica (strain LVS)
A7N9A5 3.77e-164 466 62 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q21K42 3.8e-164 467 63 3 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P57349 7.15e-163 463 59 0 355 3 mnmA tRNA-specific 2-thiouridylase MnmA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q145K0 6.64e-162 461 60 2 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Paraburkholderia xenovorans (strain LB400)
Q63QY5 3.63e-161 459 59 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia pseudomallei (strain K96243)
A3NDE4 3.63e-161 459 59 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia pseudomallei (strain 668)
Q7U353 3.96e-161 459 57 0 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Blochmanniella floridana
A1V076 8.33e-161 458 59 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia mallei (strain SAVP1)
Q62H98 8.33e-161 458 59 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia mallei (strain ATCC 23344)
A2S5A6 8.33e-161 458 59 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia mallei (strain NCTC 10229)
A3MP84 8.33e-161 458 59 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia mallei (strain NCTC 10247)
Q0BI73 1.03e-160 458 59 1 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A9AH63 1.3e-160 458 60 1 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia multivorans (strain ATCC 17616 / 249)
B2SX74 1.83e-160 457 60 3 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q3JNT6 1.83e-160 457 59 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia pseudomallei (strain 1710b)
A3NZ55 1.83e-160 457 59 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia pseudomallei (strain 1106a)
Q2SZ45 4.23e-160 457 58 2 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8XVV4 1.13e-159 455 59 1 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2UC85 2.79e-159 454 60 1 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Ralstonia pickettii (strain 12J)
P59460 7.89e-159 453 57 1 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q46XF1 1.4e-158 452 59 2 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B1YTE9 2.43e-158 452 58 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia ambifaria (strain MC40-6)
Q1GZF5 4.58e-158 451 59 1 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q0ADM9 1.23e-157 449 57 1 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A4G213 1.85e-156 447 59 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Herminiimonas arsenicoxydans
Q39JI1 1.9e-156 447 58 2 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B1JVW3 1.91e-156 447 58 2 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia orbicola (strain MC0-3)
Q1LJ45 2.85e-156 446 58 2 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B1YJE9 3.51e-156 446 59 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B9DNH6 6.2e-156 446 57 3 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus carnosus (strain TM300)
A6SUW6 7.1e-156 446 58 5 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Janthinobacterium sp. (strain Marseille)
Q0VQ25 8.68e-156 445 61 2 355 3 mnmA tRNA-specific 2-thiouridylase MnmA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B2JGI9 9.17e-156 446 58 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q9KDF2 1.54e-155 444 58 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q0K720 1.34e-154 442 59 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8K9Q8 1.47e-154 442 57 0 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A4JBM2 3.34e-154 442 58 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia vietnamiensis (strain G4 / LMG 22486)
B3R6Q0 6.33e-154 440 58 2 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q5WWV9 1.33e-153 439 56 1 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Legionella pneumophila (strain Lens)
Q82VV0 1.42e-153 439 56 1 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q31GM9 4.8e-153 439 60 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q5ZVQ1 6.08e-153 437 56 1 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IBN1 8.34e-153 437 56 1 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Legionella pneumophila (strain Corby)
A4SZU5 1.3e-152 437 59 3 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q49Y59 1.39e-152 437 57 3 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q039P7 3.24e-152 436 58 3 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q5X5H6 6.03e-152 435 56 1 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Legionella pneumophila (strain Paris)
B1HUL3 8.99e-152 435 56 3 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Lysinibacillus sphaericus (strain C3-41)
Q4L6W8 6.16e-151 433 57 3 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus haemolyticus (strain JCSC1435)
Q8CSA5 7.62e-151 432 57 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNS9 7.62e-151 432 57 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q3J9J6 8.14e-151 432 58 1 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A6TUB2 1.96e-150 431 58 2 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Alkaliphilus metalliredigens (strain QYMF)
Q88V96 6.3e-150 431 57 4 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B2IRK2 1.06e-149 430 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae (strain CGSP14)
Q47AW0 1.15e-149 429 58 5 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Dechloromonas aromatica (strain RCB)
Q5KWT8 1.22e-149 429 57 2 357 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Geobacillus kaustophilus (strain HTA426)
C1CI29 1.22e-149 430 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae (strain P1031)
Q92BK1 1.58e-149 429 56 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B8ZK04 1.64e-149 429 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q21RZ7 2.6e-149 429 56 4 380 3 mnmA tRNA-specific 2-thiouridylase MnmA Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
C1CAE7 2.9e-149 429 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae (strain 70585)
A4IR87 3.29e-149 429 57 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Geobacillus thermodenitrificans (strain NG80-2)
Q7MBE1 3.81e-149 429 55 2 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A3CRB2 6.16e-149 428 59 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus sanguinis (strain SK36)
Q8CWW0 6.37e-149 428 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04MV1 6.37e-149 428 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B1I833 1.01e-148 427 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae (strain Hungary19A-6)
Q1BZ27 1.03e-148 428 58 2 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia orbicola (strain AU 1054)
A0K4M4 1.03e-148 428 58 2 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia cenocepacia (strain HI2424)
A0AIW1 1.12e-148 427 56 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8CXC7 1.61e-148 427 55 3 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A8AU84 1.61e-148 427 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q2KZ71 2.27e-148 426 57 6 372 3 mnmA tRNA-specific 2-thiouridylase MnmA Bordetella avium (strain 197N)
C1CP03 2.31e-148 426 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae (strain Taiwan19F-14)
Q97T38 2.31e-148 426 59 3 364 1 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q2YT57 3.46e-148 426 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain bovine RF122 / ET3-1)
B0S3R4 3.53e-148 426 58 4 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q8DRS4 4.21e-148 426 58 3 368 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B4EE50 4.26e-148 426 58 2 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q03EZ6 4.74e-148 426 56 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q8Y714 4.79e-148 426 56 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
C1CBU0 7.68e-148 425 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae (strain JJA)
A8MEV9 1.13e-147 424 58 2 355 3 mnmA tRNA-specific 2-thiouridylase MnmA Alkaliphilus oremlandii (strain OhILAs)
A1K983 1.2e-147 424 59 7 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Azoarcus sp. (strain BH72)
Q5WHN4 1.36e-147 424 55 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Shouchella clausii (strain KSM-K16)
Q931Q6 1.9e-147 424 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X333 1.9e-147 424 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain Mu3 / ATCC 700698)
A8Z4F9 2.12e-147 424 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain USA300 / TCH1516)
Q6GG82 2.12e-147 424 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain MRSA252)
Q99TM8 2.12e-147 424 56 4 362 1 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain N315)
A6QHG3 2.12e-147 424 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain Newman)
Q5HFE1 2.12e-147 424 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain COL)
A5ITE6 2.12e-147 424 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain JH9)
Q2FXV6 2.12e-147 424 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGA5 2.12e-147 424 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain USA300)
A6U290 2.12e-147 424 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain JH1)
Q8D397 2.17e-147 424 52 0 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Wigglesworthia glossinidia brevipalpis
B5E605 2.22e-147 424 59 3 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pneumoniae serotype 19F (strain G54)
Q71ZF8 2.57e-147 424 56 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Listeria monocytogenes serotype 4b (strain F2365)
C1KVF9 2.57e-147 424 56 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Listeria monocytogenes serotype 4b (strain CLIP80459)
B8DDZ8 2.93e-147 424 55 2 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Listeria monocytogenes serotype 4a (strain HCC23)
Q8NW84 4.4e-147 423 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain MW2)
Q6G8U8 4.4e-147 423 56 4 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Staphylococcus aureus (strain MSSA476)
A4VYE7 6.07e-147 423 58 3 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus suis (strain 05ZYH33)
A4W4N7 6.07e-147 423 58 3 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus suis (strain 98HAH33)
Q6HDD0 7.51e-147 422 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634E9 7.51e-147 422 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus cereus (strain ZK / E33L)
B9IYG1 7.51e-147 422 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus cereus (strain Q1)
A0RJ05 7.51e-147 422 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus thuringiensis (strain Al Hakam)
B9DWD3 1.03e-146 422 58 3 368 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q81JE5 1.08e-146 422 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus anthracis
Q5F7G4 1.18e-146 422 57 3 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1WTT7 1.32e-146 422 56 6 371 3 mnmA tRNA-specific 2-thiouridylase MnmA Ligilactobacillus salivarius (strain UCC118)
A7GT74 1.72e-146 422 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q730D7 3.31e-146 421 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus cereus (strain ATCC 10987 / NRS 248)
A1TWB8 3.58e-146 421 55 4 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Paracidovorax citrulli (strain AAC00-1)
Q5P7R7 4.68e-146 421 57 7 371 3 mnmA tRNA-specific 2-thiouridylase MnmA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q820U1 5.51e-146 421 57 5 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Enterococcus faecalis (strain ATCC 700802 / V583)
Q812R6 5.79e-146 420 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A9VIM2 6.74e-146 420 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus mycoides (strain KBAB4)
Q3SKH7 7.5e-146 419 59 2 355 3 mnmA tRNA-specific 2-thiouridylase MnmA Thiobacillus denitrificans (strain ATCC 25259)
Q2Y6T6 1.04e-145 419 58 1 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
P66979 5.33e-145 418 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66978 5.33e-145 418 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus agalactiae serotype III (strain NEM316)
Q5M249 7.64e-145 417 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ9 7.64e-145 417 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus thermophilus (strain CNRZ 1066)
Q65GR9 1.13e-144 417 56 3 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A2RLX1 1.99e-144 417 55 4 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Lactococcus lactis subsp. cremoris (strain MG1363)
A8YUQ2 2.72e-144 416 55 5 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Lactobacillus helveticus (strain DPC 4571)
Q030C8 3.04e-144 416 55 4 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Lactococcus lactis subsp. cremoris (strain SK11)
Q1JED4 3.8e-144 416 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q3JYG1 4.15e-144 416 57 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B5XJA6 5.4e-144 415 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M49 (strain NZ131)
Q122U9 7e-144 416 54 4 376 3 mnmA tRNA-specific 2-thiouridylase MnmA Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q03I88 1.21e-143 414 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
B9MIA2 1.22e-143 414 56 4 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Acidovorax ebreus (strain TPSY)
A2RH05 2.81e-143 414 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J455 2.81e-143 414 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q5X9C1 2.81e-143 414 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q7U359 3.09e-143 413 57 5 372 3 mnmA tRNA-specific 2-thiouridylase MnmA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7U387 3.09e-143 413 57 5 372 3 mnmA tRNA-specific 2-thiouridylase MnmA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q1JJD5 3.31e-143 413 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J988 3.31e-143 413 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M12 (strain MGAS2096)
A1KUY0 3.77e-143 413 58 3 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q5L186 3.79e-143 413 56 2 361 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Geobacillus kaustophilus (strain HTA426)
Q9CHA1 4.97e-143 413 55 4 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Lactococcus lactis subsp. lactis (strain IL1403)
O35020 5.69e-143 412 56 3 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus subtilis (strain 168)
A1VTY5 5.7e-143 414 54 5 379 3 mnmA tRNA-specific 2-thiouridylase MnmA Polaromonas naphthalenivorans (strain CJ2)
P58075 6.03e-143 412 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M1
Q5FKU0 7.2e-143 412 55 5 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q7U375 8.42e-143 412 56 5 372 3 mnmA tRNA-specific 2-thiouridylase MnmA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8NZ00 9.32e-143 412 58 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M18 (strain MGAS8232)
A1WD47 1.1e-142 412 55 4 374 3 mnmA tRNA-specific 2-thiouridylase MnmA Acidovorax sp. (strain JS42)
A9M0Y5 1.1e-142 412 58 3 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Neisseria meningitidis serogroup C (strain 053442)
Q48QM8 1.98e-142 411 57 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M28 (strain MGAS6180)
B1XX60 2.26e-142 411 56 4 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q0A8N7 2.6e-142 411 59 2 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9JYJ6 2.78e-142 411 58 3 355 3 mnmA tRNA-specific 2-thiouridylase MnmA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A2SLT0 4.4e-142 411 54 6 390 3 mnmA tRNA-specific 2-thiouridylase MnmA Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A5CW80 1.03e-141 409 55 3 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A8FFP0 1.17e-141 409 55 3 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus pumilus (strain SAFR-032)
A7Z745 1.98e-141 409 55 4 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P0DC35 3.65e-141 408 57 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DC34 3.65e-141 408 57 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q38XI3 4.49e-141 408 56 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Latilactobacillus sakei subsp. sakei (strain 23K)
A9NDN1 6.83e-141 407 53 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Coxiella burnetii (strain RSA 331 / Henzerling II)
A9IQK6 8.05e-141 407 56 5 371 3 mnmA tRNA-specific 2-thiouridylase MnmA Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B4U0P1 1.51e-140 407 57 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q8P9A1 2e-140 406 55 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RT32 2e-140 406 55 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Xanthomonas campestris pv. campestris (strain B100)
Q4UUJ7 2e-140 406 55 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Xanthomonas campestris pv. campestris (strain 8004)
Q820W2 2.65e-140 405 53 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B6IZW5 2.66e-140 406 53 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Coxiella burnetii (strain CbuG_Q212)
C0MGQ2 3.07e-140 406 57 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus equi subsp. zooepidemicus (strain H70)
Q04B58 3.87e-140 405 54 5 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
A9KE87 5.15e-140 405 53 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Coxiella burnetii (strain Dugway 5J108-111)
Q1GAS1 8.13e-140 405 54 5 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
C0MB53 8.48e-140 405 56 3 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Streptococcus equi subsp. equi (strain 4047)
B6J7H5 8.54e-140 405 53 2 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Coxiella burnetii (strain CbuK_Q154)
Q74JW9 8.69e-140 405 54 5 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A1WEN1 9.83e-140 404 53 4 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Verminephrobacter eiseniae (strain EF01-2)
Q042R4 2.48e-139 404 54 5 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q9JTJ9 3.51e-139 403 57 3 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q3BTY6 4.44e-138 400 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B4SIN4 5.78e-138 400 55 3 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Stenotrophomonas maltophilia (strain R551-3)
Q8PL08 5.83e-138 400 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Xanthomonas axonopodis pv. citri (strain 306)
Q03QJ0 1.26e-137 399 55 5 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B2FQX2 2.14e-137 399 55 3 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Stenotrophomonas maltophilia (strain K279a)
A9BS40 6.1e-137 397 55 4 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Delftia acidovorans (strain DSM 14801 / SPH-1)
A1AX17 1.31e-136 396 53 3 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Ruthia magnifica subsp. Calyptogena magnifica
Q6MA75 3.22e-136 395 54 4 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Protochlamydia amoebophila (strain UWE25)
Q5GZR1 1.06e-135 394 54 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SMD7 1.06e-135 394 54 2 357 3 mnmA1 tRNA-specific 2-thiouridylase MnmA Xanthomonas oryzae pv. oryzae (strain PXO99A)
B2G6L9 7.23e-135 392 54 6 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJ48 7.23e-135 392 54 6 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Limosilactobacillus reuteri (strain DSM 20016)
B2GB92 1.25e-134 392 52 6 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q9PDD9 5.5e-133 387 52 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Xylella fastidiosa (strain 9a5c)
A5EVB4 2.97e-132 385 55 4 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Dichelobacter nodosus (strain VCS1703A)
B0U6Q7 1.36e-131 384 52 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Xylella fastidiosa (strain M12)
Q87DM0 1.91e-131 384 52 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9X8 1.91e-131 384 52 2 356 3 mnmA tRNA-specific 2-thiouridylase MnmA Xylella fastidiosa (strain M23)
Q2P2Q7 1.26e-130 382 53 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q6F152 2.07e-127 373 50 6 374 3 mnmA tRNA-specific 2-thiouridylase MnmA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q9PKA7 1.97e-122 360 50 7 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlamydia muridarum (strain MoPn / Nigg)
Q6MTG1 1.11e-121 358 46 6 379 3 mnmA tRNA-specific 2-thiouridylase MnmA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q2SRW8 2.67e-121 358 46 5 378 3 mnmA tRNA-specific 2-thiouridylase MnmA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A5IYK6 7.85e-121 357 50 6 371 3 mnmA tRNA-specific 2-thiouridylase MnmA Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
A1WWV9 1.47e-120 356 50 3 361 3 mnmA tRNA-specific 2-thiouridylase MnmA Halorhodospira halophila (strain DSM 244 / SL1)
Q9Z8A5 1.58e-120 355 50 5 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlamydia pneumoniae
O84289 3.24e-120 354 49 7 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BBR8 6.94e-120 353 49 7 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B7K3 6.94e-120 353 49 7 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q3KM75 1.83e-119 352 49 7 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q057R1 1.33e-118 351 50 2 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A9NFP7 3e-118 350 47 4 372 3 mnmA tRNA-specific 2-thiouridylase MnmA Acholeplasma laidlawii (strain PG-8A)
B5ZBP8 3.54e-118 350 47 6 374 3 mnmA tRNA-specific 2-thiouridylase MnmA Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Q820E9 4.32e-118 349 49 7 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q5L6D1 4.42e-116 344 50 9 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlamydia abortus (strain DSM 27085 / S26/3)
Q253W3 1.77e-114 340 48 6 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlamydia felis (strain Fe/C-56)
Q98Q11 1.57e-113 338 47 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Mycoplasmopsis pulmonis (strain UAB CTIP)
A8ES36 4.26e-113 337 47 2 363 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Aliarcobacter butzleri (strain RM4018)
A0M3J2 3.26e-110 330 46 10 399 3 mnmA tRNA-specific 2-thiouridylase MnmA Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q6YR90 2.85e-109 327 44 5 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Onion yellows phytoplasma (strain OY-M)
Q4A634 7.13e-109 326 46 8 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Mycoplasmopsis synoviae (strain 53)
Q9PQ88 2.59e-108 325 48 9 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJ41 2.59e-108 325 48 9 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q2NIM9 2.74e-108 325 44 4 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Aster yellows witches'-broom phytoplasma (strain AYWB)
B1VAX7 1.76e-107 322 45 4 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Phytoplasma australiense
Q8CXQ3 3.35e-107 322 46 8 376 3 mnmA tRNA-specific 2-thiouridylase MnmA Malacoplasma penetrans (strain HF-2)
B3PM68 4.16e-107 322 46 6 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Metamycoplasma arthritidis (strain 158L3-1)
A6H0G9 2.96e-104 315 42 9 399 3 mnmA tRNA-specific 2-thiouridylase MnmA Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q6KHK4 4.6e-103 311 43 7 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q4A9Q7 4.91e-103 311 44 8 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q600M2 4.91e-103 311 44 8 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Mesomycoplasma hyopneumoniae (strain 232)
Q4A7U1 1.26e-102 310 44 8 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Mesomycoplasma hyopneumoniae (strain 7448)
A5FHA9 1.47e-99 303 42 10 400 3 mnmA tRNA-specific 2-thiouridylase MnmA Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q5ZKW0 8.11e-99 302 40 5 393 2 TRMU Mitochondrial tRNA-specific 2-thiouridylase 1 Gallus gallus
Q8RAH7 3.4e-98 298 44 9 369 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q67LS2 3.7e-97 296 43 6 372 3 mnmA tRNA-specific 2-thiouridylase MnmA Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B1ZZ32 4.02e-97 296 43 8 376 3 mnmA tRNA-specific 2-thiouridylase MnmA Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
B2A5K1 4.2e-97 296 42 6 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B0K0P8 5.07e-97 295 43 9 369 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Thermoanaerobacter sp. (strain X514)
B0K991 5.07e-97 295 43 9 369 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
O75648 2.86e-96 295 40 5 385 1 TRMU Mitochondrial tRNA-specific 2-thiouridylase 1 Homo sapiens
Q9W5B6 2.38e-95 292 40 5 359 2 CG3021 Mitochondrial tRNA-specific 2-thiouridylase 1 Drosophila melanogaster
B2UPK4 3.36e-95 290 46 6 349 3 mnmA tRNA-specific 2-thiouridylase MnmA Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q74A22 1.51e-94 289 41 7 375 3 mnmA tRNA-specific 2-thiouridylase MnmA Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q9DAT5 3.84e-94 290 39 5 385 1 Trmu Mitochondrial tRNA-specific 2-thiouridylase 1 Mus musculus
Q5RB73 3.76e-93 288 39 6 386 2 TRMU Mitochondrial tRNA-specific 2-thiouridylase 1 Pongo abelii
A5GE36 5.25e-93 286 43 8 374 3 mnmA tRNA-specific 2-thiouridylase MnmA Geotalea uraniireducens (strain Rf4)
Q3AA24 2.04e-92 284 43 7 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q39XA9 2.17e-92 284 41 7 377 3 mnmA tRNA-specific 2-thiouridylase MnmA Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q503J2 3.43e-92 285 40 5 385 2 trmu Mitochondrial tRNA-specific 2-thiouridylase 1 Danio rerio
Q8XJH3 5.26e-91 280 39 6 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Clostridium perfringens (strain 13 / Type A)
Q0TPH2 5.26e-91 280 39 6 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B7K1G5 1.49e-90 278 41 6 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Rippkaea orientalis (strain PCC 8801 / RF-1)
A7GHC7 2.08e-90 278 40 6 360 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q0SS39 2.3e-90 278 39 6 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Clostridium perfringens (strain SM101 / Type A)
B1ILH4 2.44e-90 278 40 6 360 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Clostridium botulinum (strain Okra / Type B1)
A8Z5W4 3.38e-90 278 41 8 386 3 mnmA tRNA-specific 2-thiouridylase MnmA Karelsulcia muelleri (strain GWSS)
Q894S7 5.18e-90 277 41 7 366 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Clostridium tetani (strain Massachusetts / E88)
Q18BE2 7.54e-90 277 39 7 368 3 mnmA tRNA-specific 2-thiouridylase MnmA Clostridioides difficile (strain 630)
Q02BG1 1e-89 277 41 8 378 3 mnmA tRNA-specific 2-thiouridylase MnmA Solibacter usitatus (strain Ellin6076)
A5I5Y9 1.35e-89 276 40 6 360 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FXG3 1.35e-89 276 40 6 360 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Clostridium botulinum (strain ATCC 19397 / Type A)
B1KZE1 1.38e-89 276 40 7 366 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Clostridium botulinum (strain Loch Maree / Type A3)
B3E966 7.1e-89 274 42 9 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A5N749 7.47e-89 274 41 7 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
A7GCM3 1.06e-88 274 40 7 366 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I123 1.14e-88 274 40 7 366 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FT69 1.14e-88 274 40 7 366 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Clostridium botulinum (strain ATCC 19397 / Type A)
B1IIY2 1.19e-88 274 40 7 366 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Clostridium botulinum (strain Okra / Type B1)
Q8YX56 1.22e-88 273 41 6 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B0KC14 1.52e-88 274 40 8 369 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A9KPI9 1.61e-88 273 40 6 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B1WC37 2.09e-88 276 37 6 412 2 Trmu Mitochondrial tRNA-specific 2-thiouridylase 1 Rattus norvegicus
Q3M5R7 2.64e-88 273 41 6 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B2THM7 2.66e-88 273 40 7 371 3 mnmA tRNA-specific 2-thiouridylase MnmA Clostridium botulinum (strain Eklund 17B / Type B)
A6LSF2 2.73e-88 273 40 6 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q8R7F0 2.85e-88 273 39 7 368 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B0K584 3.29e-88 273 40 8 369 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Thermoanaerobacter sp. (strain X514)
Q7NBZ0 3.58e-88 281 41 9 376 3 ribF/mnmA Trifunctional protein RibF/MnmA Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q3A3F8 5.34e-88 272 43 9 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B8CWH7 5.95e-88 272 40 6 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B1XM11 6.76e-88 272 41 6 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B1KZJ2 7.06e-88 271 40 6 360 3 mnmA2 tRNA-specific 2-thiouridylase MnmA 2 Clostridium botulinum (strain Loch Maree / Type A3)
B0JVR4 7.15e-88 271 40 6 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B1X0U7 1.39e-87 271 40 7 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q3B625 2.61e-87 271 39 7 371 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B2J5L9 1.39e-86 268 39 6 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
P73755 4.67e-86 267 41 6 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A3DDC8 5.74e-85 265 41 8 368 3 mnmA tRNA-specific 2-thiouridylase MnmA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B2V3V9 8.62e-85 264 40 7 357 3 mnmA tRNA-specific 2-thiouridylase MnmA Clostridium botulinum (strain Alaska E43 / Type E3)
A5D3F0 1.82e-84 263 39 7 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q97GY2 4.51e-84 262 39 6 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A0Q152 3.37e-83 259 40 5 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Clostridium novyi (strain NT)
A9AYA7 7.09e-83 259 40 8 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q5MZ36 1.05e-82 258 39 7 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31N30 1.05e-82 258 39 7 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B7KHE5 2.61e-82 257 39 6 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Gloeothece citriformis (strain PCC 7424)
Q17440 3.25e-82 258 40 13 380 3 mttu-1 Probable mitochondrial tRNA-specific 2-thiouridylase 1 Caenorhabditis elegans
A4J2K1 5.28e-82 257 38 7 371 3 mnmA tRNA-specific 2-thiouridylase MnmA Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A0L678 7.3e-82 256 39 6 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q3ATZ5 1.73e-81 256 38 7 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlorobium chlorochromatii (strain CaD3)
P47537 2.42e-81 255 38 6 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
A5UV64 3.41e-81 255 40 7 377 3 mnmA tRNA-specific 2-thiouridylase MnmA Roseiflexus sp. (strain RS-1)
B0CE39 4.42e-81 254 38 7 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Acaryochloris marina (strain MBIC 11017)
A4SD47 5.89e-81 254 36 6 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q2RHY7 1.79e-80 253 40 7 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B0TFA7 8.1e-80 252 39 8 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B3EN11 8.26e-80 251 37 5 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlorobium phaeobacteroides (strain BS1)
Q118B7 3.75e-79 249 39 8 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Trichodesmium erythraeum (strain IMS101)
Q2LWA6 5.75e-79 249 40 8 359 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Syntrophus aciditrophicus (strain SB)
Q896F5 5.79e-79 249 40 5 355 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Clostridium tetani (strain Massachusetts / E88)
A1AQ29 1.04e-78 248 40 8 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q2RSS1 1.05e-78 249 39 9 368 3 mnmA tRNA-specific 2-thiouridylase MnmA Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q5SLN5 1.54e-78 248 40 9 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72GX1 1.54e-78 248 40 9 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A1BI85 4.61e-78 247 38 7 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A7NK07 4.62e-78 247 40 8 375 3 mnmA tRNA-specific 2-thiouridylase MnmA Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q2JY34 7.22e-78 246 39 6 350 3 mnmA tRNA-specific 2-thiouridylase MnmA Synechococcus sp. (strain JA-3-3Ab)
Q8R5X3 9.67e-78 246 39 10 368 3 mnmA1 tRNA-specific 2-thiouridylase MnmA 1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q2JM78 1.01e-77 246 39 6 349 3 mnmA tRNA-specific 2-thiouridylase MnmA Synechococcus sp. (strain JA-2-3B'a(2-13))
Q0SMH1 1.13e-77 246 35 7 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Borreliella afzelii (strain PKo)
B5ENY8 1.69e-77 245 39 6 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J5X6 1.69e-77 245 39 6 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q8CWM0 2.94e-77 245 39 8 366 3 mnmA tRNA-specific 2-thiouridylase MnmA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P75365 2.99e-77 245 39 10 373 3 mnmA tRNA-specific 2-thiouridylase MnmA Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q7TTR0 1.09e-76 245 37 7 381 3 mnmA tRNA-specific 2-thiouridylase MnmA Prochlorococcus marinus (strain MIT 9313)
B7J2N7 2.82e-76 242 35 7 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Borreliella burgdorferi (strain ZS7)
B0SPC6 3.14e-76 243 38 8 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SG84 3.14e-76 243 38 8 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
O13947 4.29e-76 243 37 10 379 3 SPAC23H4.04 Mitochondrial tRNA-specific 2-thiouridylase 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O51625 7.53e-76 241 34 7 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
A4XLP5 1.08e-75 241 37 7 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q660I8 1.11e-75 240 36 7 359 3 mnmA tRNA-specific 2-thiouridylase MnmA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q1J090 1.43e-75 241 39 9 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A2CB44 1.69e-75 242 37 7 381 3 mnmA tRNA-specific 2-thiouridylase MnmA Prochlorococcus marinus (strain MIT 9303)
Q24US9 1.74e-75 240 37 8 379 3 mnmA tRNA-specific 2-thiouridylase MnmA Desulfitobacterium hafniense (strain Y51)
Q7MBC9 1.83e-75 240 37 9 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7VAT9 1.74e-74 239 36 8 379 3 mnmA tRNA-specific 2-thiouridylase MnmA Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q8KBD3 2.9e-74 237 37 6 364 3 mnmA tRNA-specific 2-thiouridylase MnmA Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q68X66 3.74e-74 237 37 7 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A8F172 4.34e-74 237 36 6 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Rickettsia massiliae (strain Mtu5)
Q2RZN9 5.04e-74 237 40 9 373 3 mnmA tRNA-specific 2-thiouridylase MnmA Salinibacter ruber (strain DSM 13855 / M31)
B1LV15 6.86e-74 237 38 10 372 3 mnmA tRNA-specific 2-thiouridylase MnmA Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B8G5F1 7.75e-74 236 40 6 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Chloroflexus aggregans (strain MD-66 / DSM 9485)
A8EZE8 8.37e-74 236 37 8 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Rickettsia canadensis (strain McKiel)
A5GUP6 8.83e-74 236 38 9 371 3 mnmA tRNA-specific 2-thiouridylase MnmA Synechococcus sp. (strain RCC307)
B5RQ24 8.96e-74 236 34 8 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Borrelia recurrentis (strain A1)
Q9ZDM1 1.13e-73 235 37 7 365 3 mnmA tRNA-specific 2-thiouridylase MnmA Rickettsia prowazekii (strain Madrid E)
Q3AV73 1.31e-73 236 37 8 370 3 mnmA tRNA-specific 2-thiouridylase MnmA Synechococcus sp. (strain CC9902)
B5RMM8 1.49e-73 235 34 8 363 3 mnmA tRNA-specific 2-thiouridylase MnmA Borrelia duttonii (strain Ly)
A0LEL7 1.53e-73 235 38 8 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q92IL0 1.6e-73 235 36 6 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q4UM73 2.23e-73 235 36 6 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A5CFJ6 2.42e-73 235 35 6 362 3 mnmA tRNA-specific 2-thiouridylase MnmA Orientia tsutsugamushi (strain Boryong)
A8GRJ5 4.35e-73 234 36 6 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Rickettsia rickettsii (strain Sheila Smith)
B0BWZ7 4.35e-73 234 36 6 367 3 mnmA tRNA-specific 2-thiouridylase MnmA Rickettsia rickettsii (strain Iowa)
Q1D6N0 4.4e-73 234 39 9 358 3 mnmA tRNA-specific 2-thiouridylase MnmA Myxococcus xanthus (strain DK1622)
C4K1W0 4.69e-73 234 36 6 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Rickettsia peacockii (strain Rustic)
Q30SP2 5.45e-73 233 39 12 360 3 mnmA tRNA-specific 2-thiouridylase MnmA Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A6WZ88 6.46e-73 235 36 9 369 3 mnmA tRNA-specific 2-thiouridylase MnmA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A6KZV1 7.33e-73 234 37 8 372 3 mnmA3 tRNA-specific 2-thiouridylase MnmA 3 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A5GMJ9 7.72e-73 234 36 8 373 3 mnmA tRNA-specific 2-thiouridylase MnmA Synechococcus sp. (strain WH7803)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS04365
Feature type CDS
Gene mnmA
Product tRNA 2-thiouridine(34) synthase MnmA
Location 980553 - 981656 (strand: -1)
Length 1104 (nucleotides) / 367 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1940
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03054 tRNA methyl transferase HUP domain
PF20258 Aminomethyltransferase beta-barrel domain
PF20259 tRNA methyl transferase PRC-barrel domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0482 Translation, ribosomal structure and biogenesis (J) J tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00566 tRNA-uridine 2-sulfurtransferase [EC:2.8.1.13] Sulfur relay system -

Protein Sequence

MSDNSQKKVIVGMSGGVDSSVSAYLLKEQGYQVVGLFMKNWEEDDDTEYCSASADLADAQAVCDKLGIELHTINFAAEYWDNVFEHFLSEYKAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATGHYVRRRDIDGKSQLLRGVDNNKDQSYFLYTLSHQQIAQSLFPVGEMEKPEVRKIAEKLDLATAKKKDSTGICFIGERKFTDFLSRYLPAKPGPIVTVDGETIGEHQGLMYHTLGQRKGLGIGGTKEGSEDPWYVVDKDVANNILIVAQGHEHPRLMSVGLIAQQLHWVAREPITEAFRCTVKTRYRQADIPCTVTPLDEDKIEVRFDYPVAAVTPGQSAVFYQDEVCLGGGIIETRIQE

Flanking regions ( +/- flanking 50bp)

TAGTGATATGGTAAAGTATGGCGCTTATTTTTCCGCAGTGAGATCCATTCATGTCAGATAACAGCCAAAAAAAAGTCATCGTTGGAATGTCCGGTGGCGTAGATTCATCCGTCTCAGCCTATCTTCTTAAGGAACAGGGATATCAGGTCGTTGGTCTGTTTATGAAGAACTGGGAAGAAGATGACGATACAGAATATTGCTCAGCTTCTGCCGACCTTGCCGACGCGCAAGCCGTGTGCGATAAGCTTGGCATAGAACTTCACACTATCAATTTTGCCGCTGAATATTGGGATAATGTATTTGAACACTTTTTATCTGAATATAAAGCTGGCCGCACCCCTAATCCCGATATTCTATGTAATAAAGAGATAAAATTTAAAGCATTTTTAGAATATGCAGCTGAAGATTTAGGGGCCGACTATATTGCAACGGGCCACTATGTTCGTCGCCGTGATATTGATGGTAAAAGCCAATTACTGCGCGGTGTTGATAACAACAAAGATCAAAGCTACTTCTTATATACATTAAGTCATCAGCAAATCGCCCAAAGCCTTTTCCCTGTCGGTGAAATGGAAAAACCTGAGGTGAGAAAAATTGCAGAGAAGCTTGATTTAGCCACCGCCAAGAAAAAAGACTCTACGGGGATCTGTTTTATCGGTGAACGCAAGTTTACTGATTTCTTATCGCGCTATTTACCTGCCAAACCGGGTCCTATCGTCACCGTAGATGGCGAAACCATTGGTGAACATCAAGGGTTGATGTATCACACCTTAGGTCAACGTAAAGGTCTGGGTATCGGTGGCACAAAAGAAGGTAGCGAAGATCCTTGGTATGTAGTCGATAAAGATGTTGCAAATAACATATTAATTGTCGCACAAGGTCATGAACACCCTCGATTAATGTCCGTAGGCTTAATTGCTCAACAACTTCATTGGGTCGCAAGAGAGCCTATTACCGAAGCTTTTCGTTGCACGGTGAAAACACGATATCGCCAAGCTGATATTCCGTGTACAGTAACACCATTAGATGAAGATAAAATTGAAGTCCGTTTTGACTATCCTGTTGCTGCTGTTACACCAGGGCAATCGGCCGTTTTCTATCAAGACGAAGTCTGTTTAGGTGGCGGTATTATTGAAACACGTATTCAGGAGTAGATGTGGCTAAAGATTTTCGTGATATTACCCTTGCACTGGCAGGTATCTGC