Homologs in group_1493

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09635 FBDBKF_09635 61.9 Morganella morganii S1 cof pyridoxal phosphatase
EHELCC_04435 EHELCC_04435 61.9 Morganella morganii S2 cof pyridoxal phosphatase
NLDBIP_04435 NLDBIP_04435 61.9 Morganella morganii S4 cof pyridoxal phosphatase
LHKJJB_14195 LHKJJB_14195 61.9 Morganella morganii S3 cof pyridoxal phosphatase
HKOGLL_12340 HKOGLL_12340 61.9 Morganella morganii S5 cof pyridoxal phosphatase
F4V73_RS00705 F4V73_RS00705 61.2 Morganella psychrotolerans - pyridoxal phosphatase

Distribution of the homologs in the orthogroup group_1493

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1493

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P21829 4.42e-109 319 55 0 272 1 ybhA Pyridoxal phosphate phosphatase YbhA Escherichia coli (strain K12)
P96741 4.87e-26 106 30 9 285 1 ywtE 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YwtE Bacillus subtilis (strain 168)
P42962 3.5e-23 98 29 7 272 1 ycsE 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YcsE Bacillus subtilis (strain 168)
A4TPD3 2.41e-22 96 28 5 284 3 cof HMP-PP phosphatase Yersinia pestis (strain Pestoides F)
Q1CL56 2.41e-22 96 28 5 284 3 cof HMP-PP phosphatase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZP3 2.41e-22 96 28 5 284 3 cof HMP-PP phosphatase Yersinia pestis bv. Antiqua (strain Angola)
Q7CK25 2.41e-22 96 28 5 284 3 cof HMP-PP phosphatase Yersinia pestis
Q1C4L7 2.41e-22 96 28 5 284 3 cof HMP-PP phosphatase Yersinia pestis bv. Antiqua (strain Antiqua)
P0A8Y7 6.73e-22 95 29 9 294 3 yidA Sugar phosphatase YidA Shigella flexneri
P0A8Y5 6.73e-22 95 29 9 294 1 yidA Sugar phosphatase YidA Escherichia coli (strain K12)
P0A8Y6 6.73e-22 95 29 9 294 3 yidA Sugar phosphatase YidA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B5Y0T3 1.05e-21 94 30 7 260 3 cof HMP-PP phosphatase Klebsiella pneumoniae (strain 342)
B1JHR2 1.75e-21 94 28 5 284 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FLB5 1.75e-21 94 28 5 284 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66DS5 3.48e-21 93 28 5 284 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype I (strain IP32953)
P94592 4.95e-21 93 26 6 279 1 ywpJ Phosphatase YwpJ Bacillus subtilis (strain 168)
P70947 5.86e-21 92 29 10 277 1 yitU 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YitU Bacillus subtilis (strain 168)
P44447 8.94e-21 92 24 4 282 1 HI_0003 Putative phosphatase HI_0003 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B2K6W6 1.45e-20 91 27 5 284 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A1JNL2 4.33e-20 90 28 8 285 3 cof HMP-PP phosphatase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P47507 1.59e-19 89 25 4 279 3 MG265 Putative phosphatase MG265 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P54947 1.82e-19 88 26 8 282 3 yxeH Putative phosphatase YxeH Bacillus subtilis (strain 168)
A8GAR8 3.36e-19 87 30 6 251 3 cof HMP-PP phosphatase Serratia proteamaculans (strain 568)
A6T5I9 4.15e-19 87 29 7 260 3 cof HMP-PP phosphatase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P75399 4.2e-19 87 25 4 272 3 MPN_383 Putative phosphatase MPN_383 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O07539 4.93e-19 87 24 5 282 1 yhaX Stress response protein YhaX Bacillus subtilis (strain 168)
Q45494 6.42e-19 86 28 11 285 3 ykrA Putative phosphatase YkrA Bacillus subtilis (strain 168)
P53661 7.35e-19 87 26 10 283 3 MCAP_0732 Putative phosphatase MCAP_0732 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q5XD45 1.41e-18 86 28 7 289 1 M6_Spy0533 Putative phosphatase M6_Spy0533 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
A7MFJ6 4.01e-18 85 29 5 249 3 cof HMP-PP phosphatase Cronobacter sakazakii (strain ATCC BAA-894)
P27848 5.5e-17 81 26 4 249 1 yigL Pyridoxal phosphate phosphatase YigL Escherichia coli (strain K12)
Q8X8L6 6.4e-17 81 26 4 249 3 yigL Pyridoxal phosphate phosphatase YigL Escherichia coli O157:H7
Q83M49 1.35e-16 80 27 5 248 3 cof HMP-PP phosphatase Shigella flexneri
Q0T7D7 1.35e-16 80 27 5 248 3 cof HMP-PP phosphatase Shigella flexneri serotype 5b (strain 8401)
B7LMD3 4.14e-16 79 27 5 248 3 cof HMP-PP phosphatase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8FKA2 6.3e-16 79 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q325F5 7.87e-16 78 27 5 248 3 cof HMP-PP phosphatase Shigella boydii serotype 4 (strain Sb227)
Q3Z4V2 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Shigella sonnei (strain Ss046)
B2U4Q1 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RF89 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli (strain UTI89 / UPEC)
B1LJK3 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli (strain SMS-3-5 / SECEC)
B6HZQ3 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli (strain SE11)
Q0TKJ5 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8B5 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O1:K1 / APEC
A7ZXA4 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O9:H4 (strain HS)
B7NJ48 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MDA5 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJR9 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZIK4 8.16e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O139:H28 (strain E24377A / ETEC)
B5Z3V4 9.19e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE50 9.19e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O157:H7
B7MQG2 9.76e-16 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O81 (strain ED1a)
P46891 1.06e-15 78 27 5 248 1 cof HMP-PP phosphatase Escherichia coli (strain K12)
B1XFN4 1.06e-15 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli (strain K12 / DH10B)
C4ZTK3 1.06e-15 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli (strain K12 / MC4100 / BW2952)
B7N900 1.21e-15 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7M3T9 1.21e-15 78 27 5 248 3 cof HMP-PP phosphatase Escherichia coli O8 (strain IAI1)
B7L683 4.55e-15 76 27 5 248 3 cof HMP-PP phosphatase Escherichia coli (strain 55989 / EAEC)
P75792 8.56e-15 75 25 10 277 1 ybiV Sugar phosphatase YbiV Escherichia coli (strain K12)
A4W7B7 3.07e-14 74 28 6 253 3 cof HMP-PP phosphatase Enterobacter sp. (strain 638)
Q8L5Z4 4.5e-14 75 24 7 285 1 YBEY Endoribonuclease YBEY, chloroplastic Arabidopsis thaliana
Q57SA6 1.47e-13 72 27 6 249 3 cof HMP-PP phosphatase Salmonella choleraesuis (strain SC-B67)
B5EXJ7 2.54e-13 71 27 6 249 3 cof HMP-PP phosphatase Salmonella agona (strain SL483)
Q8Z8U7 2.72e-13 71 27 6 249 3 cof HMP-PP phosphatase Salmonella typhi
A8AK07 2.78e-13 71 27 4 248 3 cof HMP-PP phosphatase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B4TMD5 4.19e-13 70 27 6 249 3 cof HMP-PP phosphatase Salmonella schwarzengrund (strain CVM19633)
B1IZE7 4.61e-13 70 27 5 230 3 cof HMP-PP phosphatase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A9MM14 4.76e-13 70 27 7 250 3 cof HMP-PP phosphatase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B4SWV0 5.78e-13 70 27 6 249 3 cof HMP-PP phosphatase Salmonella newport (strain SL254)
Q8ZRB6 6.63e-13 70 27 6 249 3 cof HMP-PP phosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BD74 6.63e-13 70 27 6 249 3 cof HMP-PP phosphatase Salmonella paratyphi A (strain AKU_12601)
A9MWC0 6.63e-13 70 27 6 249 3 cof HMP-PP phosphatase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFM4 6.63e-13 70 27 6 249 3 cof HMP-PP phosphatase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T9F2 6.63e-13 70 27 6 249 3 cof HMP-PP phosphatase Salmonella heidelberg (strain SL476)
B5R6V8 6.63e-13 70 27 6 249 3 cof HMP-PP phosphatase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QU47 6.63e-13 70 27 6 249 3 cof HMP-PP phosphatase Salmonella enteritidis PT4 (strain P125109)
B5FKW1 6.63e-13 70 27 6 249 3 cof HMP-PP phosphatase Salmonella dublin (strain CT_02021853)
P21878 1.83e-12 65 46 1 78 3 None Uncharacterized protein in pdhA 5'region (Fragment) Geobacillus stearothermophilus
P57140 3.61e-12 68 25 9 273 3 BU028/BU029 Putative phosphatase BU028/BU029 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A5ULS3 3.89e-11 64 33 2 110 3 Msm_0946 Phosphoglycolate phosphatase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q89B25 7.38e-11 64 25 5 243 3 bbp_030 Putative phosphatase bbp_030 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P43051 8.65e-11 64 24 8 277 3 None Putative phosphatase in upp 3'region Metamycoplasma hominis
Q8KA73 1.13e-09 61 24 8 277 3 BUsg_029 Putative phosphatase BUsg_029 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P75809 1.29e-09 60 23 7 280 1 ybjI 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YbjI Escherichia coli (strain K12)
O27143 4.57e-09 58 38 0 73 3 MTH_1071 Phosphoglycolate phosphatase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9UTA6 1.75e-08 57 25 13 274 1 SPAC25B8.12c Uncharacterized hydrolase C25B8.12c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q32JB1 2.56e-08 55 33 2 101 5 cof Putative HMP-PP phosphatase Shigella dysenteriae serotype 1 (strain Sd197)
O29805 3.65e-08 56 23 8 266 3 AF_0444 Phosphoglycolate phosphatase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P44771 4.61e-08 56 24 11 279 3 HI_0597 Putative phosphatase HI_0597 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5XAQ1 1.2e-07 55 25 8 261 1 M6_Spy1377 Putative bifunctional phosphatase/peptidyl-prolyl cis-trans isomerase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8TK72 2.95e-07 53 23 9 273 3 MA_3544 Phosphoglycolate phosphatase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P75511 1.74e-06 51 23 7 246 3 MPN_264 Putative phosphatase MPN_264 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A3CWU5 3.63e-06 50 22 5 269 3 Memar_1919 Phosphoglycolate phosphatase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q12UG6 1.23e-05 48 31 6 145 3 Mbur_2034 Phosphoglycolate phosphatase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
A3DNN7 1.52e-05 48 20 10 275 3 Smar_1152 Phosphoglycolate phosphatase Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
Q8TYT9 2.32e-05 48 38 0 72 3 MK0203 Phosphoglycolate phosphatase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
A0B7J8 2.34e-05 47 35 0 77 3 Mthe_0884 Phosphoglycolate phosphatase Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
P95967 2.36e-05 48 41 0 53 3 SSO0094 Phosphoglycolate phosphatase 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
P95967 0.000844 43 32 1 71 3 SSO0094 Phosphoglycolate phosphatase 1 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q8PZN6 4.39e-05 47 35 0 70 3 MM_0456 Phosphoglycolate phosphatase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q4J8P4 4.55e-05 47 28 0 81 3 Saci_1518 Phosphoglycolate phosphatase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
O07565 0.000132 46 33 0 83 1 ntdB Kanosamine-6-phosphate phosphatase Bacillus subtilis (strain 168)
P75360 0.000278 45 24 9 273 3 MPN_427 Putative phosphatase MPN_427 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9YE03 0.000467 44 22 8 274 3 APE_0766 Phosphoglycolate phosphatase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
O50129 0.000769 43 21 8 268 1 PH1421 Phosphoglycolate phosphatase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P95931 0.000771 43 35 2 81 3 SSO2157 Phosphoglycolate phosphatase 2 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02955
Feature type CDS
Gene -
Product pyridoxal phosphatase
Location 651677 - 652498 (strand: -1)
Length 822 (nucleotides) / 273 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1493
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08282 haloacid dehalogenase-like hydrolase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0561 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases

Kegg Ortholog Annotation(s)

Protein Sequence

MSYRVIALDLDGTLLDDQKRILPGSLTALNLARKAGVKVLIVTGRHHVAIHPFYQALDLDTPAICCNGTYLYDYLGKKVLESDPLTPEETRAVLDLVKQTDVHHLVYADDAMMYDQLTAAVQRTLNWADTLPLAQRPNLVKVDDFYQAMHHVDSIWKIATTTPNHDELRALIEQVEQQVGLECEWSWVDQVDIAKKGNSKGRRLQRWVEANGMKMSDVMAFGDNFNDLSMLEHVGLGVAMGNASDEVKARAKLVTKNNNQPGIAETIHKYILS

Flanking regions ( +/- flanking 50bp)

AACGTGTAACATCAGCATCATTGCATCTTTATACTATCAAGGGGCTTATTATGTCGTACCGCGTTATTGCACTGGATCTTGATGGCACATTGCTTGATGACCAAAAACGTATCCTACCGGGATCTTTAACTGCTCTTAATCTTGCCAGAAAAGCGGGCGTTAAAGTACTCATTGTAACAGGTCGTCACCATGTTGCTATTCATCCATTCTATCAAGCGCTAGATCTTGATACACCCGCTATCTGTTGTAATGGTACTTATCTTTACGACTACCTCGGTAAAAAAGTGCTTGAATCTGATCCTTTAACCCCCGAAGAAACACGCGCGGTACTCGACTTGGTTAAACAAACCGATGTGCATCATTTAGTCTATGCAGATGATGCAATGATGTATGATCAACTTACCGCTGCCGTACAACGTACACTTAATTGGGCTGATACTCTTCCTCTGGCACAACGCCCTAATTTAGTCAAAGTAGATGATTTTTACCAAGCAATGCATCATGTTGATTCTATCTGGAAAATAGCGACCACAACCCCCAATCACGATGAGTTACGTGCTTTAATCGAACAAGTAGAACAACAAGTCGGCTTAGAGTGTGAATGGTCTTGGGTCGATCAAGTTGATATCGCCAAGAAAGGTAATAGCAAAGGTCGCCGTTTACAGCGTTGGGTTGAAGCTAATGGCATGAAGATGAGTGATGTTATGGCGTTTGGTGATAACTTCAATGACTTAAGTATGTTAGAGCATGTTGGTTTAGGTGTTGCTATGGGCAACGCATCAGATGAGGTCAAAGCACGCGCTAAACTGGTGACTAAAAATAATAATCAGCCCGGTATTGCAGAGACTATTCATAAATATATTTTGTCTTAAATACTTGCTATTCAAACAACAAAGCCTCATCTATGACGAGGCTTTATTTT