Homologs in group_1512

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09780 FBDBKF_09780 43.2 Morganella morganii S1 lysR DNA-binding transcriptional regulator, LysR family
EHELCC_04580 EHELCC_04580 43.2 Morganella morganii S2 lysR DNA-binding transcriptional regulator, LysR family
NLDBIP_04580 NLDBIP_04580 43.2 Morganella morganii S4 lysR DNA-binding transcriptional regulator, LysR family
LHKJJB_14050 LHKJJB_14050 43.2 Morganella morganii S3 lysR DNA-binding transcriptional regulator, LysR family
HKOGLL_12485 HKOGLL_12485 43.2 Morganella morganii S5 lysR DNA-binding transcriptional regulator, LysR family
F4V73_RS00565 F4V73_RS00565 44.9 Morganella psychrotolerans - LysR family transcriptional regulator

Distribution of the homologs in the orthogroup group_1512

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1512

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P30864 1.01e-38 141 29 5 303 3 yafC Uncharacterized HTH-type transcriptional regulator YafC Escherichia coli (strain K12)
P72131 2.17e-34 130 30 2 289 1 ptxR HTH-type transcriptional regulator PtxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P43011 1.75e-33 127 29 4 297 3 HI_1364 Uncharacterized HTH-type transcriptional regulator HI_1364 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9JPU9 3.03e-29 116 26 3 299 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup C (strain 8013)
P67662 1.08e-28 114 28 2 289 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli (strain K12)
P67663 1.08e-28 114 28 2 289 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67664 1.08e-28 114 28 2 289 3 aaeR HTH-type transcriptional activator AaeR Escherichia coli O157:H7
A0A0H2ZDG9 2.2e-28 114 29 7 305 3 PA14_22550 HTH-type transcriptional repressor PA14_22550 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9JXW7 4.4e-28 113 25 4 301 1 crgA HTH-type transcriptional regulator CrgA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P76250 2.65e-27 111 28 3 290 1 dmlR HTH-type transcriptional regulator DmlR Escherichia coli (strain K12)
P37641 7.37e-25 104 27 5 292 3 yhjC Uncharacterized HTH-type transcriptional regulator YhjC Escherichia coli (strain K12)
P52689 7.85e-23 99 24 5 301 3 ltrA Probable HTH-type transcriptional regulator LtrA Klebsiella pneumoniae
Q1R6S1 1.55e-21 95 27 8 289 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain UTI89 / UPEC)
Q8FDH0 1.55e-21 95 27 8 289 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45463 2.41e-21 95 27 8 289 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli (strain K12)
Q0TD46 2.64e-21 94 27 8 289 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8XBK9 4.64e-21 94 27 8 289 3 ttdR HTH-type transcriptional activator TtdR Escherichia coli O157:H7
P39647 3.58e-20 91 37 0 126 1 cysL HTH-type transcriptional regulator CysL Bacillus subtilis (strain 168)
P77333 4.29e-20 91 25 8 300 1 pgrR HTH-type transcriptional regulator PgrR Escherichia coli (strain K12)
Q57083 6.68e-17 82 26 6 294 1 perR HTH-type transcriptional regulator PerR Escherichia coli (strain K12)
P45099 1.69e-16 81 30 1 180 3 gcvA Glycine cleavage system transcriptional activator homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8X4M5 2.69e-16 80 28 8 250 3 cynR HTH-type transcriptional regulator CynR Escherichia coli O157:H7
Q47005 9.54e-16 79 27 7 246 3 nac Nitrogen assimilation regulatory protein nac Escherichia coli (strain K12)
P27111 1.15e-15 79 27 8 245 1 cynR HTH-type transcriptional regulator CynR Escherichia coli (strain K12)
P0A9F6 4.16e-15 77 27 7 260 1 gcvA Glycine cleavage system transcriptional activator Escherichia coli (strain K12)
P0A9F7 4.16e-15 77 27 7 260 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9F8 4.16e-15 77 27 7 260 3 gcvA Glycine cleavage system transcriptional activator Escherichia coli O157:H7
P46068 4.26e-15 77 24 7 304 2 dsdC HTH-type transcriptional regulator DsdC Escherichia coli (strain K12)
P75836 4.49e-15 77 22 5 299 3 ycaN Uncharacterized HTH-type transcriptional regulator YcaN Escherichia coli (strain K12)
P37459 5.12e-15 77 22 6 294 3 sinR Probable HTH-type transcriptional regulator SinR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P14145 5.32e-15 77 24 4 254 3 ampR HTH-type transcriptional activator AmpR Rhodobacter capsulatus
Q01610 1.42e-14 75 24 3 286 3 PA2220 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6B936 6.85e-14 73 27 7 261 3 rbcR Probable RuBisCO transcriptional regulator Gracilaria tenuistipitata var. liui
Q08597 7.41e-14 73 29 10 256 3 nac Nitrogen assimilation regulatory protein nac Klebsiella aerogenes
P12529 7.91e-14 73 27 5 239 1 ampR HTH-type transcriptional activator AmpR Citrobacter freundii
P33634 9.25e-14 73 24 10 307 3 yfiE Uncharacterized HTH-type transcriptional regulator YfiE Escherichia coli (strain K12)
P0ACR4 1.03e-13 73 25 12 289 1 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli (strain K12)
P0ACR5 1.03e-13 73 25 12 289 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACR6 1.03e-13 73 25 12 289 3 yeiE Uncharacterized HTH-type transcriptional regulator YeiE Escherichia coli O157:H7
P42507 1.2e-13 73 24 8 294 3 hvrB AhcY transcriptional activator HvrB Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q1XDT2 2.51e-13 72 27 8 269 3 rbcR Probable RuBisCO transcriptional regulator Neopyropia yezoensis
P52696 4.76e-13 71 25 8 250 3 ybhD Uncharacterized HTH-type transcriptional regulator YbhD Escherichia coli (strain K12)
P51205 6.34e-13 71 26 8 269 3 rbcR Probable RuBisCO transcriptional regulator Porphyra purpurea
P0C6D1 7.21e-13 70 25 8 302 3 irgB Iron-regulated virulence regulatory protein IrgB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F9F9 8.24e-13 70 25 7 301 3 irgB Iron-regulated virulence regulatory protein IrgB Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
O19892 2.62e-12 69 27 9 258 3 rbcR Probable RuBisCO transcriptional regulator Cyanidium caldarium
P0A2Q4 6.26e-12 68 25 6 263 3 metR HTH-type transcriptional regulator MetR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q5 6.26e-12 68 25 6 263 3 metR HTH-type transcriptional regulator MetR Salmonella typhi
P52665 9.52e-12 65 38 1 109 3 budR HTH-type transcriptional regulator BudR (Fragment) Klebsiella aerogenes
P55576 1.09e-11 67 24 6 285 3 NGR_a02420 Uncharacterized HTH-type transcriptional regulator y4mQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P52660 1.22e-11 67 23 5 258 3 blaA HTH-type transcriptional regulator BlaA Proteus vulgaris
P0A9G1 1.23e-11 67 26 5 257 3 metR HTH-type transcriptional regulator MetR Shigella flexneri
P0A9F9 1.23e-11 67 26 5 257 1 metR HTH-type transcriptional regulator MetR Escherichia coli (strain K12)
P0A9G0 1.23e-11 67 26 5 257 3 metR HTH-type transcriptional regulator MetR Escherichia coli O157:H7
P52666 1.3e-11 67 31 4 160 3 budR HTH-type transcriptional regulator BudR Raoultella terrigena
Q3MCB5 1.51e-11 67 24 10 305 3 rbcR Probable RuBisCO transcriptional regulator Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8YQ82 2.05e-11 67 24 9 299 3 rbcR Probable RuBisCO transcriptional regulator Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P16931 2.32e-11 66 29 2 144 3 dgdR HTH-type transcriptional regulator DgdR Burkholderia cepacia
Q57748 2.4e-11 66 27 2 174 3 MJ0300 Uncharacterized HTH-type transcriptional regulator MJ0300 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P96725 3.33e-11 66 26 11 264 3 ywqM Uncharacterized HTH-type transcriptional regulator YwqM Bacillus subtilis (strain 168)
P73123 4.56e-11 66 31 3 147 3 rbcR Probable RuBisCO transcriptional regulator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A2CI69 4.56e-11 65 26 9 287 3 rbcR Probable RuBisCO transcriptional regulator Chlorokybus atmophyticus
P77744 8.92e-11 65 27 2 174 3 abgR HTH-type transcriptional regulator AbgR Escherichia coli (strain K12)
Q85G62 1.09e-10 64 25 8 261 3 rbcR Probable RuBisCO transcriptional regulator Cyanidioschyzon merolae (strain NIES-3377 / 10D)
O06703 1.21e-10 64 22 5 296 3 bbuR HTH-type transcriptional regulator BbuR Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P70785 1.21e-10 64 25 5 247 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
O34685 1.41e-10 64 24 5 243 1 yofA HTH-type transcriptional regulator YofA Bacillus subtilis (strain 168)
O78432 1.59e-10 64 23 9 298 3 rbcR Probable RuBisCO transcriptional regulator Guillardia theta
Q5N5I5 2.07e-10 63 27 10 299 3 cmpR HTH-type transcriptional activator CmpR Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q9F1R2 2.07e-10 63 27 10 299 1 cmpR HTH-type transcriptional activator CmpR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O32255 3.02e-10 63 23 11 301 3 yvbU Uncharacterized HTH-type transcriptional regulator YvbU Bacillus subtilis (strain 168)
P39376 3.41e-10 63 26 8 265 1 yjiE HTH-type transcriptional regulator YjiE Escherichia coli (strain K12)
P52686 3.65e-10 63 31 2 129 3 sdsB SDS degradation transcriptional activation protein Pseudomonas sp. (strain ATCC 19151)
P48271 4.61e-10 63 29 3 147 3 rbcR Probable RuBisCO transcriptional regulator Cyanophora paradoxa
Q8KA72 4.73e-10 62 25 8 264 3 metR HTH-type transcriptional regulator MetR Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P52658 4.77e-10 62 21 5 257 3 ampR HTH-type transcriptional activator AmpR Citrobacter koseri
P94403 5.24e-10 62 23 6 246 3 bsdA HTH-type transcriptional regulator BsdA Bacillus subtilis (strain 168)
P55181 6.8e-10 62 24 7 257 3 yxjO Uncharacterized HTH-type transcriptional regulator YxjO Bacillus subtilis (strain 168)
A0T0G2 7.69e-10 62 25 7 256 3 rbcR Probable RuBisCO transcriptional regulator Phaeodactylum tricornutum (strain CCAP 1055/1)
Q06610 1.47e-09 61 24 7 291 3 rbcR RuBisCO operon transcriptional regulator Acidithiobacillus ferrooxidans
P77559 1.74e-09 61 25 7 297 3 ynfL Uncharacterized HTH-type transcriptional regulator YnfL Escherichia coli (strain K12)
P52690 1.92e-09 61 24 9 271 3 cbbR HTH-type transcriptional regulator CbbR Cereibacter sphaeroides
P52669 2.38e-09 60 26 8 249 3 ttuA HTH-type transcriptional regulator TtuA Agrobacterium vitis
P52683 2.38e-09 60 26 4 183 3 smeR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Serratia marcescens
O07906 2.43e-09 60 24 6 230 3 yraN Uncharacterized HTH-type transcriptional regulator YraN Bacillus subtilis (strain 168)
P49518 2.9e-09 60 25 6 256 3 rbcR Probable RuBisCO transcriptional regulator Trieres chinensis
P52685 3.55e-09 60 27 4 181 3 mauR Mau operon transcriptional activator Paracoccus denitrificans
A0T0V5 5.6e-09 59 23 4 253 3 rbcR-A Probable RuBisCO transcriptional regulator Thalassiosira pseudonana
P45461 7.47e-09 59 28 2 156 3 ampR HTH-type transcriptional activator AmpR Yersinia enterocolitica
P23841 9.7e-09 58 31 2 121 3 xapR HTH-type transcriptional regulator XapR Escherichia coli (strain K12)
P76369 1.02e-08 58 21 6 275 3 yeeY Uncharacterized HTH-type transcriptional regulator YeeY Escherichia coli (strain K12)
P96194 1.56e-08 55 36 0 99 3 None Uncharacterized HTH-type transcriptional regulator in ibpB-leuC intergenic region Azotobacter vinelandii
Q4G384 1.65e-08 58 29 1 146 3 rbcR Probable RuBisCO transcriptional regulator Emiliania huxleyi
P42722 2.11e-08 58 24 7 254 3 cfxR HTH-type transcriptional regulator CfxR Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q44311 2.34e-08 57 23 10 281 3 soxR HTH-type transcriptional regulator SoxR Arthrobacter sp. (strain TE1826)
P24734 2.35e-08 57 29 2 148 1 ampR HTH-type transcriptional activator AmpR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q47141 2.6e-08 57 25 15 313 1 hcaR Hca operon transcriptional activator HcaR Escherichia coli (strain K12)
P52676 2.69e-08 57 25 1 143 3 nmcR Carbapenem-hydrolyzing beta-lactamase transcriptional activator Enterobacter cloacae
P0ACR0 2.9e-08 57 43 0 73 1 allS HTH-type transcriptional activator AllS Escherichia coli (strain K12)
P0ACR1 2.9e-08 57 43 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O157:H7
P77700 3.43e-08 57 24 9 259 1 yahB Uncharacterized HTH-type transcriptional regulator YahB Escherichia coli (strain K12)
Q8FK66 4.44e-08 57 43 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKD7 4.44e-08 57 43 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1RF30 5.38e-08 56 43 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli (strain UTI89 / UPEC)
A1A8H0 5.38e-08 56 43 0 73 3 allS HTH-type transcriptional activator AllS Escherichia coli O1:K1 / APEC
Q9S4Y7 6.07e-08 56 25 4 199 3 allS HTH-type transcriptional activator AllS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PCH2 6.07e-08 56 25 4 199 3 allS HTH-type transcriptional activator AllS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57S50 6.7e-08 56 25 4 199 3 allS HTH-type transcriptional activator AllS Salmonella choleraesuis (strain SC-B67)
O69055 7.63e-08 55 24 5 190 3 ptxE Putative HTH-type transcriptional regulator protein PtxE (Fragment) Stutzerimonas stutzeri
P42427 9.08e-08 55 23 0 121 3 tfdT HTH-type transcriptional regulator TfdT Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P94501 9.08e-08 55 23 7 259 1 gltR HTH-type transcriptional regulator GltR Bacillus subtilis (strain 168)
P0DUU5 1.06e-07 55 22 9 301 1 aceR HTH-type transcriptional regulator AceR Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q8Z8R3 1.39e-07 55 25 4 199 3 allS HTH-type transcriptional activator AllS Salmonella typhi
O68014 2.72e-07 54 29 4 125 1 benM HTH-type transcriptional regulator BenM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9X5P2 2.74e-07 54 31 3 128 2 oxyR Probable hydrogen peroxide-inducible genes activator Streptomyces viridosporus
P52659 3.57e-07 54 24 7 260 3 abaB HTH-type transcriptional regulator AbaB Streptomyces antibioticus
P05051 3.6e-07 54 28 1 144 3 ampR HTH-type transcriptional activator AmpR Enterobacter cloacae
P52678 3.7e-07 54 31 7 154 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium leprae (strain TN)
P52691 4.23e-07 53 36 2 124 3 lrrA Probable HTH-type transcriptional regulator LrrA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O33945 5.45e-07 53 31 4 123 3 None Probable cat1 operon transcriptional activator Acinetobacter lwoffii
O33812 5.78e-07 53 32 3 135 3 None Uncharacterized HTH-type transcriptional regulator in lacR 5'region (Fragment) Staphylococcus xylosus
Q765S2 6.06e-07 53 26 5 202 3 allS HTH-type transcriptional activator AllS Klebsiella pneumoniae
Q55459 7.07e-07 53 24 6 286 1 cmpR HTH-type transcriptional activator CmpR Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P94387 7.64e-07 53 29 0 109 3 ycgK Uncharacterized HTH-type transcriptional regulator YcgK Bacillus subtilis (strain 168)
P9WMF7 1.07e-06 52 24 11 272 1 Rv0377 Uncharacterized HTH-type transcriptional regulator Rv0377 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF6 1.07e-06 52 24 11 272 3 MT0391 Uncharacterized HTH-type transcriptional regulator MT0391 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O87883 1.09e-06 51 30 3 149 3 oxyR Probable hydrogen peroxide-inducible genes activator (Fragment) Mycobacterium xenopi
P71025 1.13e-06 52 24 10 269 3 czcR HTH-type transcriptional regulator CzcR Bacillus subtilis (strain 168)
Q9I6Z9 1.25e-06 52 33 0 90 3 bauR HTH-type transcriptional activator BauR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A2Q2 2.5e-06 51 26 3 143 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2Q3 2.5e-06 51 26 3 143 3 ilvY HTH-type transcriptional activator IlvY Salmonella typhi
P07774 4.51e-06 50 25 2 171 1 catM HTH-type transcriptional regulator CatM Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P05827 4.74e-06 50 25 3 143 3 ilvY HTH-type transcriptional regulator IlvY Escherichia coli (strain K12)
Q05840 5.37e-06 50 32 1 101 3 clcR HTH-type transcriptional regulator ClcR Pseudomonas putida
O34827 6.25e-06 50 21 6 248 3 ykuM Uncharacterized HTH-type transcriptional regulator YkuM Bacillus subtilis (strain 168)
Q46M54 8.06e-06 50 29 0 113 1 tfdS HTH-type transcriptional regulator TfdS Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q46M57 8.44e-06 50 29 0 113 1 tfdR HTH-type transcriptional regulator TdfR Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
P52595 1.68e-05 49 24 9 287 3 cbbR HTH-type transcriptional regulator CbbR Rhodospirillum rubrum
Q87LL6 3.32e-05 48 26 5 259 3 argP HTH-type transcriptional regulator ArgP Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O87324 8.83e-05 47 24 7 267 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium marinum
P58332 0.000119 46 21 9 256 3 cbbR HTH-type transcriptional regulator CbbR Rhizobium meliloti (strain 1021)
Q81VJ1 0.000123 46 23 10 288 3 czcR HTH-type transcriptional regulator CzcR Bacillus anthracis
O69772 0.000129 46 22 6 259 3 ampR HTH-type transcriptional activator AmpR Providencia stuartii
P27102 0.000136 46 34 2 107 3 tcbR HTH-type transcriptional regulator TcbR Pseudomonas sp. (strain P51)
Q6LMN6 0.000141 46 24 9 273 3 argP HTH-type transcriptional regulator ArgP Photobacterium profundum (strain SS9)
P33651 0.000149 46 34 2 82 3 blaA HTH-type transcriptional regulator BlaA Streptomyces cacaoi
P45349 0.000193 45 20 6 260 3 metR HTH-type transcriptional regulator MetR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A7Z5E4 0.000214 45 22 7 240 3 yofA HTH-type transcriptional regulator YofA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A0R8S0 0.000221 45 23 8 255 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis (strain Al Hakam)
Q6HPH4 0.000228 45 23 8 255 3 czcR HTH-type transcriptional regulator CzcR Bacillus thuringiensis subsp. konkukian (strain 97-27)
P52677 0.000276 45 40 0 62 3 oxyR Probable hydrogen peroxide-inducible genes activator Mycobacterium avium
Q63H01 0.000291 45 23 8 255 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ZK / E33L)
Q73EY2 0.000291 45 23 8 255 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81IX0 0.000305 45 27 4 144 3 czcR HTH-type transcriptional regulator CzcR Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P77309 0.0004 45 28 4 141 3 yneJ Uncharacterized HTH-type transcriptional regulator YneJ Escherichia coli (strain K12)
P94632 0.000403 45 40 2 70 1 lysG Lysine export transcriptional regulatory protein LysG Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P52662 0.000551 44 27 3 143 3 pecT HTH-type transcriptional regulator PecT Dickeya dadantii (strain 3937)
Q00678 0.000561 44 26 3 123 3 nocR Regulatory protein NocR Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8RQM5 0.000579 44 40 2 70 3 lysG Lysine export transcriptional regulatory protein LysG Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P74422 0.000684 44 24 1 122 3 ntcB Probable nitrogen assimilation transcriptional activator Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02835
Feature type CDS
Gene -
Product LysR family transcriptional regulator
Location 624740 - 625633 (strand: -1)
Length 894 (nucleotides) / 297 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1512
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
PF03466 LysR substrate binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0583 Transcription (K) K DNA-binding transcriptional regulator, LysR family

Protein Sequence

MQNQIDRIRSFIAVVDTGSFTQAAKYLRLSKSMVSIHIKALETELNVSLLNRNTRRFTLTETGEILYQDFRQVLVQLEQTLDKARLGQQNLQGTLRLTSTAEFGEHYILPLLHQFMCLHPQLKVQYIFNSSIDDLINHKLDLAIRLGALKDSNYRYRKLADYTIKLVVSPHLLKKYPIQEIADLAAVPYLANSNLRHSKLSQQDKINQLFSQLHSMALFETNTISALKQMALKQMGMTILPEWYIQQEITQGELVSPIPELTLLNQSINVIFPHGEHMPRKTRLFIDFLKERINSMP

Flanking regions ( +/- flanking 50bp)

ATCGTCTATCTGACAAAATAGAACTTATTGTTTAATCAGAGTAAACAATCATGCAAAATCAAATAGACCGAATTCGTTCTTTTATCGCCGTAGTAGATACAGGCTCTTTTACACAAGCAGCAAAGTATTTACGCTTAAGTAAATCAATGGTGAGTATTCATATTAAAGCATTAGAAACGGAATTAAATGTATCTCTTCTTAATCGGAATACTCGGCGCTTCACATTAACTGAAACGGGAGAAATCCTTTATCAAGATTTTCGTCAAGTTTTAGTTCAACTCGAACAAACATTAGATAAGGCACGGTTAGGACAACAAAACTTACAGGGAACTTTACGATTAACTTCAACGGCTGAATTTGGTGAACATTATATATTGCCACTTTTACATCAATTTATGTGTTTACACCCTCAACTAAAAGTGCAATATATATTCAATTCTTCTATTGATGATCTTATCAATCATAAGTTAGATTTGGCGATACGCCTTGGCGCATTAAAAGACAGTAATTATCGCTATCGCAAATTAGCAGATTACACAATCAAATTAGTGGTATCACCACATTTATTGAAAAAATATCCTATCCAAGAAATTGCAGATTTAGCGGCAGTTCCCTATCTTGCAAACAGCAATTTACGCCATAGCAAACTCAGCCAACAAGATAAAATCAATCAACTATTTTCACAATTGCACTCAATGGCACTTTTCGAAACGAATACTATTAGTGCATTAAAACAGATGGCACTCAAACAAATGGGAATGACTATATTACCAGAGTGGTACATTCAACAAGAAATAACACAGGGTGAACTTGTTAGCCCTATTCCTGAACTTACCTTATTAAATCAATCTATTAATGTCATTTTTCCACATGGTGAACATATGCCAAGAAAAACCCGTCTATTTATTGATTTTTTAAAAGAGAGAATTAATTCTATGCCCTAAAAGGTGAGGGGGAATATTGCATAACCCATATACAAGAAGTGAATGCCTTA