Homologs in group_352

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14805 FBDBKF_14805 77.8 Morganella morganii S1 fepD ABC-type Fe3+-siderophore transport system, permease component
EHELCC_15610 EHELCC_15610 77.8 Morganella morganii S2 fepD ABC-type Fe3+-siderophore transport system, permease component
NLDBIP_16140 NLDBIP_16140 77.8 Morganella morganii S4 fepD ABC-type Fe3+-siderophore transport system, permease component
LHKJJB_15700 LHKJJB_15700 77.8 Morganella morganii S3 fepD ABC-type Fe3+-siderophore transport system, permease component
HKOGLL_14820 HKOGLL_14820 77.8 Morganella morganii S5 fepD ABC-type Fe3+-siderophore transport system, permease component
F4V73_RS07605 F4V73_RS07605 77.2 Morganella psychrotolerans - iron ABC transporter permease
PMI_RS14630 PMI_RS14630 29.4 Proteus mirabilis HI4320 - iron chelate uptake ABC transporter family permease subunit

Distribution of the homologs in the orthogroup group_352

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_352

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57552 1.69e-67 218 36 3 323 3 MJ0087 Putative ABC transporter permease protein MJ0087 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q56992 5e-58 193 39 2 308 1 hmuU Hemin transport system permease protein HmuU Yersinia pestis
O34451 2.48e-46 163 37 4 284 3 yvrB Uncharacterized ABC transporter permease protein YvrB Bacillus subtilis (strain 168)
A6TAH6 4.07e-45 159 35 5 293 3 btuC Vitamin B12 import system permease protein BtuC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q7MLE7 1.17e-44 158 35 2 275 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain YJ016)
Q8D927 4.01e-44 157 36 2 275 3 btuC Vitamin B12 import system permease protein BtuC Vibrio vulnificus (strain CMCP6)
Q6LQ76 4.85e-41 149 37 4 303 3 btuC Vitamin B12 import system permease protein BtuC Photobacterium profundum (strain SS9)
B1JJ25 1.25e-40 147 32 4 298 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669Z9 1.25e-40 147 32 4 298 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype I (strain IP32953)
A9R099 1.25e-40 147 32 4 298 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX4 1.25e-40 147 32 4 298 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pestis
B2K660 1.25e-40 147 32 4 298 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FHG9 1.25e-40 147 32 4 298 3 btuC Vitamin B12 import system permease protein BtuC Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D656 1.81e-40 147 35 4 287 3 btuC Vitamin B12 import system permease protein BtuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JPQ9 1.97e-40 147 33 3 295 3 btuC Vitamin B12 import system permease protein BtuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q57130 2.08e-39 144 33 6 318 1 molB Molybdate import system permease protein MolB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9ZKW2 3.42e-38 141 36 8 331 3 jhp_0822 Probable iron chelatin transport system permease protein jhp_0822 Helicobacter pylori (strain J99 / ATCC 700824)
O05731 3.8e-38 141 36 8 331 3 HP_0889 Probable iron chelatin transport system permease protein HP_0889 Helicobacter pylori (strain ATCC 700392 / 26695)
A8GDR2 7.75e-38 140 33 3 295 3 btuC Vitamin B12 import system permease protein BtuC Serratia proteamaculans (strain 568)
Q87Q39 1.06e-37 140 34 4 262 3 btuC Vitamin B12 import system permease protein BtuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KSL2 1.94e-37 139 34 3 319 3 btuC Vitamin B12 import system permease protein BtuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8Z6I5 4.56e-37 138 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhi
Q3Z259 7.24e-37 137 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Shigella sonnei (strain Ss046)
B4T4N5 8.04e-37 137 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella newport (strain SL254)
B5RAW6 8.04e-37 137 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW1 8.04e-37 137 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella enteritidis PT4 (strain P125109)
O34832 9.75e-37 137 36 5 288 3 yfmE Fe(3+)-citrate import system permease protein YfmE Bacillus subtilis (strain 168)
Q8ZPS8 1.1e-36 137 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUF7 1.1e-36 137 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella schwarzengrund (strain CVM19633)
A9N235 1.1e-36 137 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4TGH8 1.1e-36 137 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella heidelberg (strain SL476)
B5FJA1 1.1e-36 137 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella dublin (strain CT_02021853)
B5F7F5 1.1e-36 137 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella agona (strain SL483)
A8AHA4 1.26e-36 137 34 7 301 3 btuC Vitamin B12 import system permease protein BtuC Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q57PU6 3.3e-36 135 34 5 286 3 btuC Vitamin B12 import system permease protein BtuC Salmonella choleraesuis (strain SC-B67)
B5BA35 3.59e-36 135 34 4 285 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain AKU_12601)
Q5PH87 3.59e-36 135 34 4 285 3 btuC Vitamin B12 import system permease protein BtuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A9MFB6 4.48e-36 135 35 5 282 3 btuC Vitamin B12 import system permease protein BtuC Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7LQ78 2.19e-35 134 34 5 284 3 btuC Vitamin B12 import system permease protein BtuC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q7N3Q3 2.54e-34 131 33 2 282 3 btuC Vitamin B12 import system permease protein BtuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2U360 3.07e-34 130 34 5 284 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q32FI8 3.16e-34 130 34 4 281 3 btuC Vitamin B12 import system permease protein BtuC Shigella dysenteriae serotype 1 (strain Sd197)
B7L6I4 3.3e-34 130 34 5 284 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain 55989 / EAEC)
B1IPL6 3.44e-34 130 34 5 284 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0Q3 3.44e-34 130 34 5 284 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O9:H4 (strain HS)
P40411 4.45e-34 130 29 4 304 1 feuC Iron-uptake system permease protein FeuC Bacillus subtilis (strain 168)
P15029 1.07e-33 129 33 4 296 1 fecD Fe(3+) dicitrate transport system permease protein FecD Escherichia coli (strain K12)
B7N549 1.17e-33 129 33 6 296 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q7C1M5 1.46e-33 129 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri
Q0THB7 1.61e-33 129 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MVJ0 1.66e-33 129 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O81 (strain ED1a)
Q1RB84 1.74e-33 129 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain UTI89 / UPEC)
B1LE19 1.74e-33 129 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SMS-3-5 / SECEC)
P06609 1.74e-33 129 34 5 282 1 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12)
A1ABP7 1.74e-33 129 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O1:K1 / APEC
B1XG18 1.74e-33 129 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / DH10B)
C4ZYH3 1.74e-33 129 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain K12 / MC4100 / BW2952)
B7NT65 1.74e-33 129 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MAS2 1.74e-33 129 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O45:K1 (strain S88 / ExPEC)
B7M1C0 2e-33 128 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O8 (strain IAI1)
A7ZMH9 2e-33 128 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O139:H28 (strain E24377A / ETEC)
B6I8R6 2.15e-33 128 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli (strain SE11)
B7US50 2.17e-33 128 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0T4S1 3.84e-33 127 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Shigella flexneri serotype 5b (strain 8401)
B5YPZ9 4.05e-33 127 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4L7 4.05e-33 127 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O157:H7
Q8FH26 5.2e-33 127 34 5 282 3 btuC Vitamin B12 import system permease protein BtuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q321G8 8.04e-33 127 34 5 284 3 btuC Vitamin B12 import system permease protein BtuC Shigella boydii serotype 4 (strain Sb227)
P49936 1.2e-32 127 30 5 320 3 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Bacillus subtilis (strain 168)
O34933 9.7e-32 124 31 6 317 3 yfmD Fe(3+)-citrate import system permease protein YfmD Bacillus subtilis (strain 168)
Q81L64 1.07e-31 128 33 5 289 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
Q81L64 1.77e-23 104 29 7 310 1 fpuB Petrobactin import system permease protein FpuB Bacillus anthracis
P15030 1.26e-31 124 34 6 300 1 fecC Fe(3+) dicitrate transport system permease protein FecC Escherichia coli (strain K12)
P49937 6.46e-31 122 31 4 291 3 fhuG Iron(3+)-hydroxamate import system permease protein FhuG Bacillus subtilis (strain 168)
P23876 9.6e-31 121 35 5 292 1 fepD Ferric enterobactin transport system permease protein FepD Escherichia coli (strain K12)
O31569 1.98e-30 120 29 4 334 1 yfhA Probable siderophore transport system permease protein YfhA Bacillus subtilis (strain 168)
P40410 1.09e-28 116 31 7 317 1 feuB Iron-uptake system permease protein FeuB Bacillus subtilis (strain 168)
Q9HQ19 2.03e-28 116 35 6 291 1 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G3 2.03e-28 116 35 6 291 3 btuC Cobalamin import system permease protein BtuC Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q47085 2.28e-28 115 31 8 327 3 cbrB Achromobactin transport system permease protein CbrB Dickeya dadantii (strain 3937)
O31568 6.54e-28 114 33 7 304 1 yfiZ Probable siderophore transport system permease protein YfiZ Bacillus subtilis (strain 168)
Q58286 3.39e-27 112 28 9 322 3 MJ0876 Putative ABC transporter permease protein MJ0876 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q2YX91 6.54e-24 102 31 9 319 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain bovine RF122 / ET3-1)
P06972 9.78e-23 102 32 5 278 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
P06972 2.5e-12 71 33 3 236 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Escherichia coli (strain K12)
O87656 1.78e-22 101 32 8 281 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O87656 5.41e-14 76 31 3 258 1 fhuB Iron(3+)-hydroxamate import system permease protein FhuB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6GHV2 3.08e-22 98 31 8 319 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MRSA252)
Q7A651 3.08e-22 98 31 8 319 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain N315)
Q99UX0 3.08e-22 98 31 8 319 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QG35 3.08e-22 98 31 8 319 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Newman)
Q5HGV0 3.08e-22 98 31 8 319 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain COL)
Q2FHU7 3.08e-22 98 31 8 319 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain USA300)
A7X154 3.08e-22 98 31 8 319 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8NX64 2.21e-21 95 32 7 303 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MW2)
Q6GA81 2.21e-21 95 32 7 303 3 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain MSSA476)
P23877 5.36e-21 95 32 6 288 1 fepG Ferric enterobactin transport system permease protein FepG Escherichia coli (strain K12)
Q2FZE5 1.61e-19 90 31 9 319 2 isdF Probable heme-iron transport system permease protein IsdF Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q47086 1.53e-18 88 29 4 305 3 cbrC Achromobactin transport system permease protein CbrC Dickeya dadantii (strain 3937)
P37738 2.17e-17 84 28 5 274 1 fatD Ferric-anguibactin transport system permease protein FatD Vibrio anguillarum (strain ATCC 68554 / 775)
Q81XB1 1.17e-16 82 26 6 276 1 fatD Petrobactin import system permease protein FatD Bacillus anthracis
P94418 1.06e-15 79 26 6 280 1 yclN Petrobactin import system permease protein YclN Bacillus subtilis (strain 168)
Q58287 3.98e-11 63 35 1 81 3 MJ0877 Putative ABC transporter permease protein MJ0877 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P94419 7.94e-10 62 23 8 304 1 yclO Petrobactin import system permease protein YclO Bacillus subtilis (strain 168)
Q81XB2 1.09e-08 59 24 9 305 1 fatC Petrobactin import system permease protein FatC Bacillus anthracis
P37737 0.000795 44 23 11 289 1 fatC Ferric-anguibactin transport system permease protein FatC Vibrio anguillarum (strain ATCC 68554 / 775)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01110
Feature type CDS
Gene -
Product iron ABC transporter permease
Location 272693 - 273673 (strand: 1)
Length 981 (nucleotides) / 326 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_352
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01032 FecCD transport family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0609 Inorganic ion transport and metabolism (P) P ABC-type Fe3+-siderophore transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02015 iron complex transport system permease protein - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG044280 iron ABC transporter permease VF1252 Nutritional/Metabolic factor

Protein Sequence

MILGGVLCSVLILDFTLGPSGLSLTELWNTLISPETADAGTRVIVWDIRLPYSLMAVVVGMSLGLAGAEMQTILNNPLASPFTLGVSSAAAFGAALAIVLGIGIPGVPAQWFISVNAFIFALLATLLLDFISRWMRVSTSGIILFGIALVFTFNAAVSIMQFIANEDTLQGLVFWTMGSLNRASWDKLYILLVVLVIIFPLSLMNAWKLTALRLGEDRAMSFGINVRRLRLTTLLRISIISALAVAFVGPIGFIGLVAPHIARMTFGEDHRFYLPASALIGALVLSIASLVSKNLLSGVIIPVGIVTSLVGIPFFVSIILRHRGRI

Flanking regions ( +/- flanking 50bp)

GGGTAGTGAAGGAATATCAGCGACAGATACTTCGTCGTTTCTTTTACTTAATGATATTAGGGGGCGTGTTATGTAGCGTTTTGATCCTTGATTTTACTTTAGGGCCTTCAGGATTATCGCTGACTGAACTGTGGAATACACTAATATCGCCAGAAACTGCCGATGCTGGCACTCGGGTTATTGTGTGGGATATCAGGCTACCTTACTCCCTTATGGCGGTTGTCGTTGGAATGTCACTCGGGTTAGCGGGTGCTGAAATGCAAACTATACTCAATAACCCGCTGGCAAGTCCCTTTACGCTTGGCGTCTCTTCTGCCGCTGCTTTTGGTGCTGCTTTAGCGATTGTTTTAGGGATTGGTATTCCGGGGGTTCCTGCTCAGTGGTTTATTTCAGTTAATGCGTTTATTTTCGCATTACTGGCAACGTTGTTACTGGACTTTATCTCACGTTGGATGCGAGTTTCTACCTCTGGAATTATTCTCTTTGGCATAGCGTTAGTGTTTACTTTTAATGCTGCTGTTTCCATTATGCAATTTATCGCTAACGAAGATACGCTTCAGGGATTAGTGTTCTGGACAATGGGTAGCCTTAATCGGGCATCGTGGGATAAGTTATACATTTTATTGGTTGTATTAGTGATTATCTTCCCCTTGTCATTGATGAATGCTTGGAAACTGACGGCACTTCGTCTAGGGGAAGATCGTGCGATGAGCTTTGGGATCAACGTCAGACGCTTACGCCTAACAACATTACTTCGTATTAGCATCATTTCTGCCTTGGCGGTAGCATTTGTTGGCCCAATAGGTTTTATTGGATTAGTCGCTCCTCATATTGCTCGGATGACTTTTGGCGAAGATCATCGTTTTTATTTGCCCGCAAGTGCCCTTATTGGTGCATTGGTATTATCGATAGCTTCTTTAGTCTCCAAAAACCTTTTATCTGGTGTGATTATTCCGGTGGGAATTGTGACTTCTCTTGTGGGTATCCCTTTCTTTGTTAGTATCATTTTGCGTCATCGCGGGAGAATATAATGAACACGGGATTGAATGCTGGGTTGCGTATTGAAAAGTTTTCTACGGGA