Homologs in group_1372

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08100 FBDBKF_08100 92.1 Morganella morganii S1 erpA iron-sulfur cluster insertion protein ErpA
EHELCC_13930 EHELCC_13930 92.1 Morganella morganii S2 erpA iron-sulfur cluster insertion protein ErpA
NLDBIP_14375 NLDBIP_14375 92.1 Morganella morganii S4 erpA iron-sulfur cluster insertion protein ErpA
LHKJJB_08475 LHKJJB_08475 92.1 Morganella morganii S3 erpA iron-sulfur cluster insertion protein ErpA
HKOGLL_08025 HKOGLL_08025 92.1 Morganella morganii S5 erpA iron-sulfur cluster insertion protein ErpA
F4V73_RS12900 F4V73_RS12900 93.0 Morganella psychrotolerans erpA iron-sulfur cluster insertion protein ErpA

Distribution of the homologs in the orthogroup group_1372

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1372

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EUE2 4.72e-81 235 100 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Proteus mirabilis (strain HI4320)
Q7N843 4.59e-75 220 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7CR66 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFF3 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella typhi
B4TXQ8 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella schwarzengrund (strain CVM19633)
A9N0Q2 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PD49 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUY6 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella newport (strain SL254)
B4TK32 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella heidelberg (strain SL476)
B5RHE2 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3G8 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella enteritidis PT4 (strain P125109)
B5FJ03 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella dublin (strain CT_02021853)
Q57T51 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella choleraesuis (strain SC-B67)
A9MPK5 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F8R7 6.89e-75 220 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella agona (strain SL483)
Q3Z5K1 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella sonnei (strain Ss046)
P0ACC6 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella flexneri
Q0T850 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella flexneri serotype 5b (strain 8401)
Q32JV2 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella dysenteriae serotype 1 (strain Sd197)
Q325Y3 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella boydii serotype 4 (strain Sb227)
B2U301 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWB7 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RG32 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain UTI89 / UPEC)
B1LGV9 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain SMS-3-5 / SECEC)
B6HZD2 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain SE11)
B7N825 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ACC3 2.41e-74 218 91 0 114 1 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12)
B1IQI4 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ACC4 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLH5 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7K2 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O1:K1 / APEC
A7ZWA4 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O9:H4 (strain HS)
B1XD26 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12 / DH10B)
C4ZRP9 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M197 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O8 (strain IAI1)
B7MP18 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O81 (strain ED1a)
B7NIB9 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0D6 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ACC5 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O157:H7
B7LGL8 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain 55989 / EAEC)
B7MBD9 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIK3 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHP8 2.41e-74 218 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O139:H28 (strain E24377A / ETEC)
B5Y1L3 1.24e-73 217 89 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Klebsiella pneumoniae (strain 342)
A6T4W0 1.4e-73 216 89 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A8ALD2 2.07e-73 216 89 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MGR3 8.54e-73 214 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Cronobacter sakazakii (strain ATCC BAA-894)
Q6D1Z1 1.76e-72 214 89 1 115 3 erpA Iron-sulfur cluster insertion protein ErpA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VE26 3.88e-72 213 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4W6Q3 5.05e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Enterobacter sp. (strain 638)
A8G9U9 1.11e-71 212 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Serratia proteamaculans (strain 568)
A1JJQ3 2.62e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5BAP7 2.83e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Edwardsiella ictaluri (strain 93-146)
B1JK20 1.18e-70 209 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EE9 1.18e-70 209 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPW8 1.18e-70 209 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis (strain Pestoides F)
Q1CLU5 1.18e-70 209 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E3 1.18e-70 209 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Angola)
Q0WBQ9 1.18e-70 209 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis
B2K550 1.18e-70 209 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3X3 1.18e-70 209 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM07 1.18e-70 209 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q2NVP9 1.5e-69 206 85 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Sodalis glossinidius (strain morsitans)
A5UFF5 8.01e-67 199 82 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain PittGG)
Q4QJM4 8.01e-67 199 82 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain 86-028NP)
A6VN49 4.34e-66 197 81 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P45344 5.52e-66 197 81 0 114 1 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UBF7 2.38e-65 196 80 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain PittEE)
Q9CNH3 2.68e-65 196 78 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Pasteurella multocida (strain Pm70)
A4SJ82 8.31e-64 192 79 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Aeromonas salmonicida (strain A449)
Q9X4A0 1.57e-63 191 78 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A0KNY6 1.66e-63 191 79 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B3H296 5.94e-63 189 78 0 112 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2B0 1.25e-62 189 79 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0I3N9 2.14e-62 188 78 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Histophilus somni (strain 129Pt)
B0BR51 2.76e-62 188 77 0 112 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q65SZ6 3.11e-62 188 78 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UU19 3.18e-62 188 78 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Histophilus somni (strain 2336)
B4RWS2 4.27e-62 187 73 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q6LUS1 6.42e-62 187 77 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Photobacterium profundum (strain SS9)
A1RMG3 1.52e-61 186 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain W3-18-1)
A4Y4G8 1.52e-61 186 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B5FAL7 1.7e-61 186 76 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio fischeri (strain MJ11)
Q5E2W7 1.7e-61 186 76 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MHZ0 1.88e-61 186 76 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain YJ016)
Q8DBX7 3.12e-61 185 76 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain CMCP6)
Q07YU9 6.48e-61 184 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella frigidimarina (strain NCIMB 400)
B6EL03 8.64e-61 184 74 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio salmonicida (strain LFI1238)
Q0HSF0 9.1e-61 184 74 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain MR-7)
Q0HG57 9.1e-61 184 74 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain MR-4)
A0KZS2 9.1e-61 184 74 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain ANA-3)
A9L5J9 1.05e-60 184 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS195)
A6WKM0 1.05e-60 184 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS185)
A3D1R9 1.05e-60 184 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBT9 1.05e-60 184 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS223)
Q8EHC4 4.67e-60 182 73 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8F870 5.17e-60 182 77 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Glaesserella parasuis serovar 5 (strain SH0165)
A8H175 6.28e-60 182 76 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TIR0 7.99e-60 182 76 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella halifaxensis (strain HAW-EB4)
Q15YG5 1.95e-59 181 71 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
C3LSN2 3.19e-59 180 73 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain M66-2)
Q9KU96 3.19e-59 180 73 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F947 3.19e-59 180 73 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87LY4 4.25e-59 180 72 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q47VA3 4.64e-59 180 76 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A7MUU6 6.1e-59 179 72 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio campbellii (strain ATCC BAA-1116)
B8CQR0 1.01e-58 179 76 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella piezotolerans (strain WP3 / JCM 13877)
A3QBP0 3.33e-58 178 74 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q5QVQ4 8.09e-58 177 71 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q12KD2 1.08e-57 176 72 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B7VJJ4 1.34e-57 176 71 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio atlanticus (strain LGP32)
A1ST94 3.47e-57 175 71 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q3IHQ0 1.14e-56 174 74 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudoalteromonas translucida (strain TAC 125)
Q1LTN5 2.04e-56 173 65 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Baumannia cicadellinicola subsp. Homalodisca coagulata
Q47IC1 2.37e-55 171 70 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Dechloromonas aromatica (strain RCB)
A1TYH3 3.19e-52 162 66 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1K969 4.06e-52 162 71 0 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Azoarcus sp. (strain BH72)
Q7NRT6 4.52e-52 162 63 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
C1DHX9 5.28e-52 162 67 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q0VSN8 5.68e-52 162 68 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
C4K3H0 7.12e-52 162 64 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A9I246 1.11e-51 161 66 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1S3U4 1.18e-51 161 72 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q2KV08 1.78e-51 161 64 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella avium (strain 197N)
A4XZB1 3.05e-51 160 67 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas mendocina (strain ymp)
Q5P7U0 1.4e-50 158 67 0 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q31IS8 1.45e-50 158 63 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7VUW2 1.63e-50 159 63 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3Z5 1.63e-50 159 63 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFC7 1.63e-50 159 63 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q4K514 1.9e-50 158 66 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1IFY7 2.03e-50 158 66 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas entomophila (strain L48)
Q3K5W6 2.48e-50 158 66 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain Pf0-1)
Q9I5Q6 3.22e-50 157 68 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TA1 3.22e-50 157 68 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V623 3.22e-50 157 68 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain LESB58)
A6UZG6 3.22e-50 157 68 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain PA7)
Q1GXC7 4.77e-50 157 61 0 113 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q3SF18 6.36e-50 157 63 0 110 3 erpA Putative iron-sulfur cluster insertion protein ErpA Thiobacillus denitrificans (strain ATCC 25259)
Q88QQ5 6.72e-50 157 66 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A1TUF2 9.56e-50 156 63 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paracidovorax citrulli (strain AAC00-1)
A1W3Q0 1.03e-49 157 63 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Acidovorax sp. (strain JS42)
C3K2Z6 1.16e-49 156 66 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain SBW25)
Q220S8 1.23e-49 156 64 0 110 3 erpA Putative iron-sulfur cluster insertion protein ErpA Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A4VHK9 1.78e-49 155 65 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Stutzerimonas stutzeri (strain A1501)
A4T031 2.58e-49 155 66 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q60AU6 2.58e-49 155 60 0 112 3 erpA2 Iron-sulfur cluster insertion protein ErpA 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A2SKL7 3.89e-49 155 61 0 113 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1KSG6 4.81e-49 154 61 1 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDN1 4.81e-49 154 61 1 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1IQG0 4.81e-49 154 61 1 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F6W8 4.81e-49 154 61 1 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q82UQ4 4.89e-49 155 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1AXV9 6.14e-49 154 66 0 104 3 erpA Iron-sulfur cluster insertion protein ErpA Ruthia magnifica subsp. Calyptogena magnifica
B8D7B5 6.45e-49 154 61 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D910 6.45e-49 154 61 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q1BZ43 8.16e-49 154 63 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain AU 1054)
B1JVU6 8.16e-49 154 63 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain MC0-3)
B4EET4 8.16e-49 154 63 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4K7 8.16e-49 154 63 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain HI2424)
Q124P0 9.04e-49 154 63 0 110 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q3JC94 9.74e-49 154 63 0 113 3 erpA Iron-sulfur cluster insertion protein ErpA Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q4ZMM4 1.56e-48 153 65 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas syringae pv. syringae (strain B728a)
Q889Z2 1.56e-48 153 65 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48NN6 1.56e-48 153 65 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P57307 1.89e-48 153 61 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q2S8Y5 2.03e-48 153 66 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Hahella chejuensis (strain KCTC 2396)
A5CVH1 2.09e-48 153 67 0 104 3 erpA Iron-sulfur cluster insertion protein ErpA Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B2UFK5 2.44e-48 153 60 0 112 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia pickettii (strain 12J)
B2JGV0 2.59e-48 153 61 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JBK6 2.61e-48 153 61 0 111 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0AFU6 2.89e-48 153 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q39JJ8 3.66e-48 152 61 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BI89 4.32e-48 152 61 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YTD3 4.32e-48 152 61 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia ambifaria (strain MC40-6)
A1WL78 4.83e-48 152 63 0 109 3 erpA Putative iron-sulfur cluster insertion protein ErpA Verminephrobacter eiseniae (strain EF01-2)
A1VMK3 6.11e-48 152 65 0 106 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Polaromonas naphthalenivorans (strain CJ2)
B2FJT4 6.25e-48 152 63 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Stenotrophomonas maltophilia (strain K279a)
Q8Y242 6.82e-48 152 60 0 112 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q493N7 1.04e-47 151 61 1 117 3 erpA Iron-sulfur cluster insertion protein ErpA Blochmanniella pennsylvanica (strain BPEN)
A9AH79 1.11e-47 151 61 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia multivorans (strain ATCC 17616 / 249)
Q2SZ67 1.16e-47 151 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QW5 1.16e-47 151 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain K96243)
A3NDG6 1.16e-47 151 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 668)
Q3JNR3 1.16e-47 151 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1710b)
A3NZ78 1.16e-47 151 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1106a)
A1V053 1.16e-47 151 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain SAVP1)
Q62HB8 1.16e-47 151 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain ATCC 23344)
A2S583 1.16e-47 151 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10229)
A3MP61 1.16e-47 151 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10247)
B2AH60 2.61e-47 150 58 0 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q475T0 2.61e-47 150 58 0 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0KED6 2.61e-47 150 58 0 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A9C177 2.84e-47 150 64 0 104 3 erpA Putative iron-sulfur cluster insertion protein ErpA Delftia acidovorans (strain DSM 14801 / SPH-1)
A4G1T7 4.37e-47 150 60 0 110 3 erpA Putative iron-sulfur cluster insertion protein ErpA Herminiimonas arsenicoxydans
Q13N17 5.12e-47 150 63 1 111 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Paraburkholderia xenovorans (strain LB400)
Q1LRC6 6.4e-47 149 59 0 113 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2SYK8 6.56e-47 149 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q13UB4 6.56e-47 149 60 0 111 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Paraburkholderia xenovorans (strain LB400)
A6SUP2 8.9e-47 149 60 0 110 3 erpA Putative iron-sulfur cluster insertion protein ErpA Janthinobacterium sp. (strain Marseille)
B5EQH0 9.26e-47 149 59 1 115 3 erpA Iron-sulfur cluster insertion protein ErpA Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JAH6 9.26e-47 149 59 1 115 3 erpA Iron-sulfur cluster insertion protein ErpA Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
P64343 1.08e-46 149 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P64342 1.08e-46 149 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain 9a5c)
B2I891 1.08e-46 149 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain M23)
Q21MI1 1.52e-46 148 64 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B4SLD1 3.19e-46 148 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Stenotrophomonas maltophilia (strain R551-3)
B0U4D9 3.42e-46 148 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain M12)
Q0ABJ8 6.32e-46 147 60 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q8PD57 6.45e-46 147 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RN15 6.45e-46 147 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain B100)
Q4UZE2 6.45e-46 147 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain 8004)
Q5H5J1 1.6e-45 146 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P884 1.6e-45 146 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2YBK7 1.68e-45 146 59 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8PQ32 2.02e-45 146 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas axonopodis pv. citri (strain 306)
Q3BY98 2.08e-45 146 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A1WVE3 2.65e-45 145 63 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Halorhodospira halophila (strain DSM 244 / SL1)
A4IZA5 3.65e-45 145 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGX6 3.65e-45 145 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BKU2 3.65e-45 145 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain OSU18)
A0Q5J0 3.65e-45 145 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. novicida (strain U112)
B2SDK6 3.65e-45 145 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A270 3.65e-45 145 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain LVS)
A7NDP2 3.65e-45 145 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14IC8 3.65e-45 145 61 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain FSC 198)
B0TZ08 9.79e-45 144 60 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A4JRL3 1.05e-43 141 62 0 106 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1QES5 1.19e-43 141 63 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FVP8 1.19e-43 141 63 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A9KB96 2.33e-43 141 57 1 120 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain Dugway 5J108-111)
Q83AK7 1.16e-42 139 56 1 120 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAW9 1.16e-42 139 56 1 120 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain RSA 331 / Henzerling II)
Q7VQH5 2.4e-42 138 56 2 119 3 erpA Iron-sulfur cluster insertion protein ErpA Blochmanniella floridana
Q1QSB5 2.84e-42 137 57 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B0VML0 3.96e-42 137 61 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain SDF)
B0VAE9 4.78e-42 137 61 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AYE)
A3M0R4 4.78e-42 137 61 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I2I7 4.78e-42 137 61 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain ACICU)
B7IAZ8 4.78e-42 137 61 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AB0057)
B7GUY5 4.78e-42 137 61 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AB307-0294)
O51930 5.88e-41 134 61 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A1VJJ5 6.59e-41 134 60 0 99 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Polaromonas naphthalenivorans (strain CJ2)
Q60C62 8.7e-41 134 64 0 94 3 erpA1 Iron-sulfur cluster insertion protein ErpA 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6FG12 1.18e-40 133 60 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q5X5H7 6.92e-40 132 55 1 112 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Paris)
A5IBN0 7.39e-40 132 55 1 112 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Corby)
Q5ZVQ2 2.21e-39 130 53 1 112 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WWW0 6.17e-39 129 54 1 112 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Lens)
Q8D3C7 1.07e-32 113 52 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Wigglesworthia glossinidia brevipalpis
Q89AQ6 7.54e-32 111 53 1 115 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O67709 5.76e-27 99 47 2 107 1 aq_1857 Protein aq_1857 Aquifex aeolicus (strain VF5)
O32113 7.42e-27 99 40 0 108 3 sufA Uncharacterized protein SufA Bacillus subtilis (strain 168)
Q9ZD62 8.96e-27 98 43 0 110 3 RP484 Uncharacterized protein RP484 Rickettsia prowazekii (strain Madrid E)
Q057T9 8.62e-25 93 59 0 81 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q01195 3.26e-22 86 39 0 104 3 None Uncharacterized protein in nifU 5'region Cereibacter sphaeroides
Q44540 3.68e-21 84 38 0 105 3 None Uncharacterized protein in nifU 5'region Azotobacter vinelandii
Q9ZE83 4.74e-21 84 35 1 110 3 RP063 Uncharacterized protein RP063 Rickettsia prowazekii (strain Madrid E)
Q53211 3.8e-20 81 37 0 104 3 NGR_a01210 Uncharacterized protein y4vC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q47887 7.4e-20 81 39 1 108 3 None Uncharacterized protein in nifB-nifU intergenic region Frankia alni
P0A5B0 8.78e-20 80 41 0 103 1 BQ2027_MB2227C Protein Mb2227c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMN5 8.78e-20 80 41 0 103 1 Rv2204c Protein Rv2204c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMN4 8.78e-20 80 41 0 103 3 MT2260 Protein MT2260 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q2TBG7 1.19e-19 81 38 2 107 2 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Bos taurus
Q86U28 2.83e-19 80 38 2 107 1 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Homo sapiens
Q5R788 2.95e-19 80 38 2 107 2 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Pongo abelii
Q9DCB8 3.63e-19 80 37 2 107 1 Isca2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Mus musculus
Q8LBM4 4.35e-19 79 34 1 104 2 At2g16710 Iron-sulfur assembly protein IscA-like 1, mitochondrial Arabidopsis thaliana
Q07184 8.52e-19 77 34 0 104 3 None Uncharacterized protein in nifU 5'region Rhodobacter capsulatus
P44672 9.24e-19 77 40 4 110 3 iscA Iron-binding protein IscA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
C5BEU3 9.97e-19 77 40 4 110 3 iscA Iron-binding protein IscA Edwardsiella ictaluri (strain 93-146)
Q8LCY2 2.12e-18 78 38 2 107 1 At5g03905 Iron-sulfur assembly protein IscA-like 2, mitochondrial Arabidopsis thaliana
P37029 2.67e-18 76 36 0 104 3 blr1755 Uncharacterized protein blr1755 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9XIK3 3.55e-18 78 42 2 101 2 ISCA Iron-sulfur assembly protein IscA, chloroplastic Arabidopsis thaliana
B4EZU6 6.05e-18 75 40 5 111 3 iscA Iron-binding protein IscA Proteus mirabilis (strain HI4320)
P72731 8.47e-18 75 39 3 113 3 slr1417 Uncharacterized protein slr1417 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8L8C0 1.01e-17 75 32 2 105 3 At2g36260 Iron-sulfur assembly protein IscA-like 3, mitochondrial Arabidopsis thaliana
A8GHY1 1.74e-17 74 40 4 110 3 iscA Iron-binding protein IscA Serratia proteamaculans (strain 568)
A1JKQ4 3.75e-17 73 39 4 110 3 iscA Iron-binding protein IscA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DBI9 3.79e-17 73 38 4 110 3 iscA Iron-binding protein IscA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D261 4.66e-17 73 39 4 110 3 iscA Iron-binding protein IscA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P46052 1.11e-16 73 36 2 110 2 hesB2 Protein HesB, vegetative Trichormus variabilis (strain ATCC 29413 / PCC 7937)
P46045 1.11e-16 74 40 1 96 3 nifU Nitrogen fixation protein NifU Frankia alni
Q7N226 1.22e-16 72 37 4 110 3 iscA Iron-binding protein IscA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8GLE6 1.68e-16 72 37 4 110 3 iscA Iron-binding protein IscA Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
A7MGY0 1.83e-16 72 40 4 110 3 iscA Iron-binding protein IscA Cronobacter sakazakii (strain ATCC BAA-894)
B1JRZ0 2.92e-16 71 37 4 110 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667Y3 2.92e-16 71 37 4 110 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TMV2 2.92e-16 71 37 4 110 3 iscA Iron-binding protein IscA Yersinia pestis (strain Pestoides F)
Q1CKA7 2.92e-16 71 37 4 110 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R816 2.92e-16 71 37 4 110 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZCS3 2.92e-16 71 37 4 110 3 iscA Iron-binding protein IscA Yersinia pestis
B2K9R5 2.92e-16 71 37 4 110 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C5H2 2.92e-16 71 37 4 110 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFX3 2.92e-16 71 37 4 110 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P74596 3.66e-16 71 35 0 105 1 slr1565 Uncharacterized protein slr1565 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q3YZ24 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Shigella sonnei (strain Ss046)
P0AAD1 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Shigella flexneri
Q32D36 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Shigella dysenteriae serotype 1 (strain Sd197)
Q31XW2 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Shigella boydii serotype 4 (strain Sb227)
B5XNJ9 3.7e-16 71 40 4 110 3 iscA Iron-binding protein IscA Klebsiella pneumoniae (strain 342)
B7LKB1 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LNI4 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain SMS-3-5 / SECEC)
B6I5A0 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain SE11)
B7N6B5 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AAC8 3.7e-16 71 39 4 110 1 iscA Iron-binding protein IscA Escherichia coli (strain K12)
B1IWD3 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AAC9 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEV7 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AE65 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli O1:K1 / APEC
B1XB03 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain K12 / DH10B)
C4ZXA3 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M7N1 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli O8 (strain IAI1)
B7MYG2 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli O81 (strain ED1a)
B7NRH7 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0AAD0 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli O157:H7
B7LDC0 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain 55989 / EAEC)
B7MIL8 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGX4 3.7e-16 71 39 4 110 3 iscA Iron-binding protein IscA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q80W96 4.75e-16 71 33 1 106 2 Isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Rattus norvegicus
Q54P40 5.76e-16 73 30 1 107 3 isca2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Dictyostelium discoideum
Q9D924 5.89e-16 71 33 1 106 2 Isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Mus musculus
A6TCE9 6.03e-16 70 40 4 110 3 iscA Iron-binding protein IscA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
O43045 9.72e-16 72 33 2 115 3 isa2 Iron-sulfur assembly protein 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P46053 1.65e-15 70 39 4 111 3 hesB Protein HesB Leptolyngbya boryana
Q7CQ12 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFZ8 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella typhi
B4TRX3 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella schwarzengrund (strain CVM19633)
B5BAW8 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella paratyphi A (strain AKU_12601)
C0PYK9 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella paratyphi C (strain RKS4594)
A9N1X7 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PNG5 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TDB4 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella heidelberg (strain SL476)
B5RD10 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5A0 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella enteritidis PT4 (strain P125109)
B5FR83 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella dublin (strain CT_02021853)
Q57LH1 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella choleraesuis (strain SC-B67)
A9MHJ6 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F1B8 1.69e-15 69 38 4 110 3 iscA Iron-binding protein IscA Salmonella agona (strain SL483)
Q4R5F0 1.75e-15 70 33 1 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Macaca fascicularis
Q9BUE6 1.75e-15 70 33 1 106 1 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Homo sapiens
Q3SZG8 1.75e-15 70 33 1 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Bos taurus
A4WDA9 2.75e-15 68 39 4 110 3 iscA Iron-binding protein IscA Enterobacter sp. (strain 638)
Q9MSA1 3.5e-15 68 35 1 107 3 ycf83 Uncharacterized protein ycf83 Galdieria sulphuraria
P78859 3.73e-15 70 30 0 105 2 isa1 Iron-sulfur assembly protein 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q54VS1 3.83e-15 69 35 2 107 3 isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Dictyostelium discoideum
P0DN75 4.65e-15 68 33 1 106 1 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Columba livia
Q5ZJ74 6.13e-15 68 33 1 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Gallus gallus
B4T0S0 6.83e-15 68 38 4 110 3 iscA Iron-binding protein IscA Salmonella newport (strain SL254)
A0A509ANY8 1.06e-14 69 33 2 114 1 SufA Iron-sulfur cluster assembly protein SufA Plasmodium berghei (strain Anka)
Q4QRC6 1.11e-14 68 34 1 106 2 isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Danio rerio
Q07821 2.72e-14 69 33 2 106 1 ISA1 Iron-sulfur assembly protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A0A146B130 3.7e-14 67 34 2 110 2 SufA Iron-sulfur cluster assembly protein SufA Plasmodium vivax
P18501 4e-14 66 40 0 82 3 hesB Protein HesB Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8T3X9 4.91e-14 66 34 2 107 1 MagR Iron-sulfur cluster assembly 1 homolog, mitochondrial Drosophila melanogaster
Q43895 2.27e-13 64 37 2 106 3 None Uncharacterized protein in nifU 5'region Azospirillum brasilense
Q8I3N6 2.46e-13 65 32 2 110 1 SufA Iron-sulfur cluster assembly protein SufA Plasmodium falciparum (isolate 3D7)
P46051 3.17e-13 64 40 0 80 2 hesB1 Protein HesB, heterocyst Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q1XDR9 4.31e-13 63 38 2 107 3 ycf83 Uncharacterized protein ycf83 Neopyropia yezoensis
P51217 3.2e-12 61 37 3 115 3 ycf83 Uncharacterized protein ycf83 Porphyra purpurea
Q12425 2.82e-10 57 30 4 131 1 ISA2 Iron-sulfur assembly protein 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P77667 5.26e-09 53 30 3 107 1 sufA Iron-sulfur cluster assembly protein SufA Escherichia coli (strain K12)
Q8KA13 4.99e-06 45 27 3 112 3 BUsg_114 Uncharacterized protein BUsg_114 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B4EZM8 6.58e-06 46 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Proteus mirabilis (strain HI4320)
B0BS54 1.54e-05 45 24 2 105 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZZ1 1.54e-05 45 24 2 105 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYM1 1.54e-05 45 24 2 105 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VNV0 3.23e-05 44 22 2 105 3 nfuA Fe/S biogenesis protein NfuA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q2NQH5 5.07e-05 43 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Sodalis glossinidius (strain morsitans)
A4ST19 0.000104 42 24 2 97 3 nfuA Fe/S biogenesis protein NfuA Aeromonas salmonicida (strain A449)
C6DH68 0.000138 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B1KM47 0.000151 42 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella woodyi (strain ATCC 51908 / MS32)
Q6CZL7 0.000153 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JHZ3 0.000172 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664J6 0.000172 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGR7 0.000172 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis (strain Pestoides F)
Q1CCL5 0.000172 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4D2 0.000172 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJI0 0.000172 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis
B2K5V9 0.000172 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2L8 0.000172 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNW0 0.000172 42 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q12IC3 0.000177 42 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A0KF09 0.000198 42 25 3 98 3 nfuA Fe/S biogenesis protein NfuA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q15N06 0.000254 41 26 1 84 3 nfuA Fe/S biogenesis protein NfuA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A9KUY3 0.00028 41 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS195)
A6WU19 0.00028 41 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS185)
A3CYW3 0.00028 41 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8ECN4 0.00028 41 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS223)
A1JSF6 0.000302 41 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C5BGT5 0.000333 41 24 2 97 3 nfuA Fe/S biogenesis protein NfuA Edwardsiella ictaluri (strain 93-146)
Q0HDK0 0.000382 41 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain MR-4)
A0L2F1 0.000382 41 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain ANA-3)
B4S1U9 0.000409 41 31 2 94 3 nfuA Fe/S biogenesis protein NfuA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q0HPU8 0.000435 41 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain MR-7)
B1J6F5 0.000521 40 29 2 100 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain W619)
Q1I898 0.000564 40 28 2 100 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas entomophila (strain L48)
A6TF37 0.000589 40 24 2 97 3 nfuA Fe/S biogenesis protein NfuA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTS2 0.000589 40 24 2 97 3 nfuA Fe/S biogenesis protein NfuA Klebsiella pneumoniae (strain 342)
Q5QZC8 0.000661 40 25 2 98 3 nfuA Fe/S biogenesis protein NfuA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q88KB2 0.000767 40 28 2 100 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W5N3 0.000767 40 28 2 100 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KKI2 0.000882 40 28 2 100 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain GB-1)
A8FPL9 0.000899 40 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella sediminis (strain HAW-EB3)
A3Q930 0.001 40 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella loihica (strain ATCC BAA-1088 / PV-4)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00990
Feature type CDS
Gene erpA
Product iron-sulfur cluster insertion protein ErpA
Location 244074 - 244418 (strand: 1)
Length 345 (nucleotides) / 114 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1372
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01521 Iron-sulphur cluster biosynthesis

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0316 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster assembly iron-binding protein IscA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15724 iron-sulfur cluster insertion protein - -

Protein Sequence

MSDDMALPLQFTDAAANKVKDLIADEENPNLRLRVYITGGGCSGFQYGFTFDDAMNEGDMTIEKQGVALVIDPMSLQYLVGGCVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

Flanking regions ( +/- flanking 50bp)

TCAATTTTTGCTGGCTGTTTTTTACTGGATTATCCAGTCTGGAGTGAACAATGAGTGATGATATGGCTCTGCCGTTACAATTTACAGATGCGGCTGCAAATAAAGTAAAAGATCTAATTGCGGATGAAGAAAACCCAAATCTGCGTCTACGTGTTTATATCACCGGTGGTGGCTGTAGCGGATTCCAGTATGGTTTTACCTTTGATGATGCTATGAATGAAGGTGATATGACCATAGAAAAACAAGGCGTTGCCTTAGTTATTGATCCAATGAGCTTGCAGTATTTAGTGGGTGGCTGTGTTGATTATACTGAAGGCCTTGAGGGCTCACGTTTTATCGTCACCAATCCTAATGCGAAAAGCACTTGTGGTTGTGGTTCATCGTTTAGTATCTGATTTTTATATTATTTGACGTCGTGGCTACACTGCCGTGCCACGGCGTTAGC