Homologs in group_1372

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08100 FBDBKF_08100 100.0 Morganella morganii S1 erpA iron-sulfur cluster insertion protein ErpA
EHELCC_13930 EHELCC_13930 100.0 Morganella morganii S2 erpA iron-sulfur cluster insertion protein ErpA
NLDBIP_14375 NLDBIP_14375 100.0 Morganella morganii S4 erpA iron-sulfur cluster insertion protein ErpA
LHKJJB_08475 LHKJJB_08475 100.0 Morganella morganii S3 erpA iron-sulfur cluster insertion protein ErpA
F4V73_RS12900 F4V73_RS12900 97.4 Morganella psychrotolerans erpA iron-sulfur cluster insertion protein ErpA
PMI_RS00990 PMI_RS00990 92.1 Proteus mirabilis HI4320 erpA iron-sulfur cluster insertion protein ErpA

Distribution of the homologs in the orthogroup group_1372

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1372

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EUE2 3.38e-75 221 92 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Proteus mirabilis (strain HI4320)
Q7N843 1.39e-74 219 91 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G9U9 1.46e-73 216 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Serratia proteamaculans (strain 568)
A4W6Q3 2.07e-73 216 89 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Enterobacter sp. (strain 638)
A1JJQ3 3.21e-73 216 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JK20 1.54e-72 214 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EE9 1.54e-72 214 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPW8 1.54e-72 214 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis (strain Pestoides F)
Q1CLU5 1.54e-72 214 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E3 1.54e-72 214 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Angola)
Q0WBQ9 1.54e-72 214 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis
B2K550 1.54e-72 214 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3X3 1.54e-72 214 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM07 1.54e-72 214 86 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8ALD2 3.12e-72 213 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7CR66 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFF3 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella typhi
B4TXQ8 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella schwarzengrund (strain CVM19633)
A9N0Q2 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PD49 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUY6 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella newport (strain SL254)
B4TK32 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella heidelberg (strain SL476)
B5RHE2 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3G8 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella enteritidis PT4 (strain P125109)
B5FJ03 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella dublin (strain CT_02021853)
Q57T51 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella choleraesuis (strain SC-B67)
A9MPK5 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F8R7 4.68e-72 213 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella agona (strain SL483)
Q6D1Z1 9.34e-72 212 89 1 115 3 erpA Iron-sulfur cluster insertion protein ErpA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3Z5K1 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella sonnei (strain Ss046)
P0ACC6 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella flexneri
Q0T850 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella flexneri serotype 5b (strain 8401)
Q32JV2 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella dysenteriae serotype 1 (strain Sd197)
Q325Y3 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella boydii serotype 4 (strain Sb227)
B2U301 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWB7 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RG32 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain UTI89 / UPEC)
B1LGV9 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain SMS-3-5 / SECEC)
B6HZD2 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain SE11)
B7N825 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ACC3 1.77e-71 211 87 0 114 1 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12)
B1IQI4 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ACC4 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLH5 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7K2 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O1:K1 / APEC
A7ZWA4 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O9:H4 (strain HS)
B1XD26 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12 / DH10B)
C4ZRP9 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M197 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O8 (strain IAI1)
B7MP18 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O81 (strain ED1a)
B7NIB9 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0D6 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ACC5 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O157:H7
B7LGL8 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain 55989 / EAEC)
B7MBD9 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIK3 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHP8 1.77e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MGR3 1.95e-71 211 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Cronobacter sakazakii (strain ATCC BAA-894)
B2VE26 5.53e-71 210 87 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B5Y1L3 8.48e-71 209 85 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Klebsiella pneumoniae (strain 342)
A6T4W0 9.47e-71 209 85 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
C5BAP7 1.48e-70 209 88 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Edwardsiella ictaluri (strain 93-146)
Q2NVP9 1.29e-68 204 84 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Sodalis glossinidius (strain morsitans)
Q9CNH3 4.3e-65 195 78 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Pasteurella multocida (strain Pm70)
A5UFF5 1e-64 194 79 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain PittGG)
Q4QJM4 1e-64 194 79 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain 86-028NP)
P45344 8.23e-64 192 78 0 114 1 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UBF7 9.92e-64 192 78 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus influenzae (strain PittEE)
Q9X4A0 1.36e-63 191 78 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A6VN49 2.61e-63 191 78 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q6LUS1 5.74e-63 189 79 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Photobacterium profundum (strain SS9)
B4RWS2 6.13e-63 189 73 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A0KNY6 1.16e-62 189 77 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q65SZ6 1.4e-62 189 79 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A9L5J9 1.87e-62 188 78 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS195)
A6WKM0 1.87e-62 188 78 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS185)
A3D1R9 1.87e-62 188 78 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBT9 1.87e-62 188 78 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS223)
B0BR51 2.03e-62 188 78 0 112 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A4SJ82 3.54e-62 188 77 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Aeromonas salmonicida (strain A449)
A1RMG3 3.95e-62 187 76 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain W3-18-1)
A4Y4G8 3.95e-62 187 76 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q15YG5 4.05e-62 187 73 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B3H296 4.52e-62 187 78 0 112 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0UU19 4.67e-62 187 80 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Histophilus somni (strain 2336)
Q0I3N9 4.99e-62 187 80 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Histophilus somni (strain 129Pt)
A3N2B0 5.63e-62 187 81 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B5FAL7 6.08e-62 187 77 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio fischeri (strain MJ11)
Q5E2W7 6.08e-62 187 77 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8DBX7 1.23e-61 186 76 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain CMCP6)
Q7MHZ0 1.31e-61 186 76 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain YJ016)
Q07YU9 2.47e-61 186 76 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella frigidimarina (strain NCIMB 400)
Q0HSF0 2.69e-61 186 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain MR-7)
Q0HG57 2.69e-61 186 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain MR-4)
A0KZS2 2.69e-61 186 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain ANA-3)
B6EL03 2.79e-61 185 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio salmonicida (strain LFI1238)
Q8EHC4 1.25e-60 184 74 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q87LY4 1.28e-60 184 77 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LSN2 2.68e-60 183 77 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain M66-2)
Q9KU96 2.68e-60 183 77 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F947 2.68e-60 183 77 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B0TIR0 1.32e-59 181 74 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella halifaxensis (strain HAW-EB4)
A8H175 1.58e-59 181 73 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8F870 2.56e-59 181 75 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Glaesserella parasuis serovar 5 (strain SH0165)
A7MUU6 4.59e-59 180 75 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio campbellii (strain ATCC BAA-1116)
Q47VA3 5.06e-59 180 75 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B7VJJ4 5.4e-59 180 75 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio atlanticus (strain LGP32)
A3QBP0 7.24e-59 179 72 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8CQR0 1.24e-58 179 73 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella piezotolerans (strain WP3 / JCM 13877)
Q5QVQ4 1.48e-58 179 73 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q12KD2 3.97e-57 175 72 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q3IHQ0 3.74e-56 172 75 0 108 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudoalteromonas translucida (strain TAC 125)
A1ST94 1.68e-55 171 72 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q1LTN5 7.76e-55 169 64 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Baumannia cicadellinicola subsp. Homalodisca coagulata
A1S3U4 5.64e-53 164 74 0 111 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q47IC1 1.82e-52 163 66 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Dechloromonas aromatica (strain RCB)
Q0VSN8 2.47e-52 163 66 1 119 3 erpA Iron-sulfur cluster insertion protein ErpA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A4XZB1 5e-52 162 69 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas mendocina (strain ymp)
C1DHX9 5.11e-52 162 66 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
C3K2Z6 5.83e-52 162 67 1 116 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain SBW25)
Q4K514 6.09e-52 162 66 1 116 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4VHK9 7.75e-52 162 66 1 116 3 erpA Iron-sulfur cluster insertion protein ErpA Stutzerimonas stutzeri (strain A1501)
Q1IFY7 9.65e-52 161 66 1 116 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas entomophila (strain L48)
Q9I5Q6 1.82e-51 160 69 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TA1 1.82e-51 160 69 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V623 1.82e-51 160 69 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain LESB58)
A6UZG6 1.82e-51 160 69 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas aeruginosa (strain PA7)
C4K3H0 2.02e-51 160 64 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q3K5W6 2.3e-51 160 66 1 116 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain Pf0-1)
Q2KV08 3.8e-51 160 65 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella avium (strain 197N)
Q4ZMM4 4.29e-51 160 66 1 116 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas syringae pv. syringae (strain B728a)
Q889Z2 4.29e-51 160 66 1 116 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48NN6 4.29e-51 160 66 1 116 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q7VUW2 6.09e-51 159 65 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3Z5 6.09e-51 159 65 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFC7 6.09e-51 159 65 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A9I246 6.65e-51 159 66 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q88QQ5 1.04e-50 159 64 1 116 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q60AU6 3.15e-50 158 62 0 112 3 erpA2 Iron-sulfur cluster insertion protein ErpA 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1TYH3 3.37e-50 157 65 0 109 3 erpA Iron-sulfur cluster insertion protein ErpA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1AXV9 5.44e-50 157 68 0 104 3 erpA Iron-sulfur cluster insertion protein ErpA Ruthia magnifica subsp. Calyptogena magnifica
A1KSG6 7.55e-50 156 64 1 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDN1 7.55e-50 156 64 1 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1IQG0 7.55e-50 156 64 1 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F6W8 7.55e-50 156 64 1 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q5P7U0 7.92e-50 157 64 0 110 3 erpA Putative iron-sulfur cluster insertion protein ErpA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7NRT6 8.44e-50 156 64 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1GXC7 1.07e-49 156 61 0 113 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1K969 1.33e-49 156 67 0 105 3 erpA Putative iron-sulfur cluster insertion protein ErpA Azoarcus sp. (strain BH72)
Q3SF18 4.38e-49 155 66 0 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Thiobacillus denitrificans (strain ATCC 25259)
Q493N7 4.72e-49 155 61 1 117 3 erpA Iron-sulfur cluster insertion protein ErpA Blochmanniella pennsylvanica (strain BPEN)
Q31IS8 4.86e-49 154 64 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2S8Y5 5.94e-49 154 67 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Hahella chejuensis (strain KCTC 2396)
A2SKL7 6.51e-49 154 65 0 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A5CVH1 8.16e-49 154 67 0 104 3 erpA Iron-sulfur cluster insertion protein ErpA Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A4T031 1.89e-48 153 64 0 110 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B8D7B5 2.43e-48 153 61 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D910 2.43e-48 153 61 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
P57307 5.84e-48 152 61 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q13N17 5.98e-48 152 63 1 111 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Paraburkholderia xenovorans (strain LB400)
B2FJT4 7.78e-48 152 64 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Stenotrophomonas maltophilia (strain K279a)
P64343 1.01e-47 152 65 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P64342 1.01e-47 152 65 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain 9a5c)
B2I891 1.01e-47 152 65 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain M23)
Q220S8 1.56e-47 151 64 0 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1TUF2 2.05e-47 150 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paracidovorax citrulli (strain AAC00-1)
A1VMK3 2.56e-47 150 64 1 110 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Polaromonas naphthalenivorans (strain CJ2)
Q82UQ4 2.61e-47 150 60 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B2UFK5 3.38e-47 150 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia pickettii (strain 12J)
A1W3Q0 3.45e-47 150 61 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Acidovorax sp. (strain JS42)
Q21MI1 3.5e-47 150 65 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B0U4D9 3.91e-47 150 65 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xylella fastidiosa (strain M12)
A1WL78 4.72e-47 150 63 0 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Verminephrobacter eiseniae (strain EF01-2)
A9C177 6.24e-47 149 64 0 104 3 erpA Putative iron-sulfur cluster insertion protein ErpA Delftia acidovorans (strain DSM 14801 / SPH-1)
Q1BZ43 6.53e-47 149 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain AU 1054)
B1JVU6 6.53e-47 149 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain MC0-3)
B4EET4 6.53e-47 149 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4K7 6.53e-47 149 60 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain HI2424)
A4JBK6 8.4e-47 149 61 0 108 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q3JC94 8.61e-47 149 66 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q2SZ67 9.5e-47 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QW5 9.5e-47 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain K96243)
A3NDG6 9.5e-47 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 668)
Q3JNR3 9.5e-47 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1710b)
A3NZ78 9.5e-47 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1106a)
A1V053 9.5e-47 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain SAVP1)
Q62HB8 9.5e-47 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain ATCC 23344)
A2S583 9.5e-47 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10229)
A3MP61 9.5e-47 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10247)
Q8Y242 9.99e-47 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2JGV0 1.02e-46 149 62 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q39JJ8 1.15e-46 149 61 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0AFU6 1.22e-46 149 61 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q0ABJ8 1.49e-46 149 62 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q0BI89 1.53e-46 149 61 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YTD3 1.53e-46 149 61 0 108 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia ambifaria (strain MC40-6)
A9AH79 1.91e-46 148 61 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia multivorans (strain ATCC 17616 / 249)
B2AH60 2.75e-46 148 57 0 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q475T0 2.75e-46 148 57 0 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0KED6 2.75e-46 148 57 0 114 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q124P0 3.21e-46 147 62 0 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polaromonas sp. (strain JS666 / ATCC BAA-500)
B4SLD1 3.44e-46 148 63 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Stenotrophomonas maltophilia (strain R551-3)
A4G1T7 5.92e-46 147 61 0 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Herminiimonas arsenicoxydans
Q1LRC6 7.53e-46 147 58 0 113 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A6SUP2 9.49e-46 146 61 0 106 3 erpA Putative iron-sulfur cluster insertion protein ErpA Janthinobacterium sp. (strain Marseille)
Q8PD57 9.67e-46 147 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RN15 9.67e-46 147 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain B100)
Q4UZE2 9.67e-46 147 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas campestris pv. campestris (strain 8004)
B2SYK8 1.38e-45 146 60 0 107 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q13UB4 1.38e-45 146 60 0 107 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Paraburkholderia xenovorans (strain LB400)
B5EQH0 1.43e-45 146 57 1 115 3 erpA Iron-sulfur cluster insertion protein ErpA Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JAH6 1.43e-45 146 57 1 115 3 erpA Iron-sulfur cluster insertion protein ErpA Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q5H5J1 3.09e-45 145 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P884 3.09e-45 145 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PQ32 3.56e-45 145 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas axonopodis pv. citri (strain 306)
Q3BY98 3.64e-45 145 62 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A4IZA5 5.19e-45 144 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NGX6 5.19e-45 144 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BKU2 5.19e-45 144 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain OSU18)
A0Q5J0 5.19e-45 144 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. novicida (strain U112)
B2SDK6 5.19e-45 144 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A270 5.19e-45 144 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain LVS)
A7NDP2 5.19e-45 144 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14IC8 5.19e-45 144 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella tularensis subsp. tularensis (strain FSC 198)
A4JRL3 8.35e-45 144 61 0 106 3 erpA2 Putative iron-sulfur cluster insertion protein ErpA 2 Burkholderia vietnamiensis (strain G4 / LMG 22486)
B0TZ08 8.77e-45 144 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A9KB96 2.52e-44 143 60 2 120 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain Dugway 5J108-111)
A1WVE3 2.91e-44 143 64 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Halorhodospira halophila (strain DSM 244 / SL1)
Q1QES5 3.57e-44 142 64 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FVP8 3.57e-44 142 64 0 106 3 erpA Iron-sulfur cluster insertion protein ErpA Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q83AK7 1.41e-43 141 60 2 120 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAW9 1.41e-43 141 60 2 120 3 erpA Iron-sulfur cluster insertion protein ErpA Coxiella burnetii (strain RSA 331 / Henzerling II)
Q1QSB5 2.42e-43 140 57 0 107 3 erpA Iron-sulfur cluster insertion protein ErpA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q2YBK7 4.36e-43 140 58 0 111 3 erpA Putative iron-sulfur cluster insertion protein ErpA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q7VQH5 1.71e-42 138 57 2 119 3 erpA Iron-sulfur cluster insertion protein ErpA Blochmanniella floridana
B0VML0 5.39e-42 137 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain SDF)
B0VAE9 9.63e-42 136 60 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AYE)
A3M0R4 9.63e-42 136 60 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I2I7 9.63e-42 136 60 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain ACICU)
B7IAZ8 9.63e-42 136 60 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AB0057)
B7GUY5 9.63e-42 136 60 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baumannii (strain AB307-0294)
Q6FG12 1.12e-41 136 61 0 110 3 erpA Iron-sulfur cluster insertion protein ErpA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
O51930 9.12e-41 134 57 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q60C62 1.79e-40 133 64 0 94 3 erpA1 Iron-sulfur cluster insertion protein ErpA 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5X5H7 3.87e-40 132 57 1 112 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Paris)
A5IBN0 4e-40 132 57 1 112 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Corby)
Q5ZVQ2 4.98e-40 132 57 1 112 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WWW0 3.2e-39 130 56 1 112 3 erpA Iron-sulfur cluster insertion protein ErpA Legionella pneumophila (strain Lens)
A1VJJ5 1.41e-38 128 60 0 95 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Polaromonas naphthalenivorans (strain CJ2)
Q89AQ6 1.14e-32 113 54 0 113 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8D3C7 2.2e-32 112 52 0 114 3 erpA Iron-sulfur cluster insertion protein ErpA Wigglesworthia glossinidia brevipalpis
Q9ZD62 3.25e-27 99 44 0 106 3 RP484 Uncharacterized protein RP484 Rickettsia prowazekii (strain Madrid E)
O67709 2e-26 97 45 2 107 1 aq_1857 Protein aq_1857 Aquifex aeolicus (strain VF5)
Q057T9 1.41e-24 92 58 0 81 3 erpA Iron-sulfur cluster insertion protein ErpA Buchnera aphidicola subsp. Cinara cedri (strain Cc)
O32113 1.84e-24 92 40 0 105 3 sufA Uncharacterized protein SufA Bacillus subtilis (strain 168)
Q01195 1.03e-21 85 39 0 104 3 None Uncharacterized protein in nifU 5'region Cereibacter sphaeroides
Q53211 2.55e-21 84 39 0 104 3 NGR_a01210 Uncharacterized protein y4vC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9ZE83 1.05e-20 82 36 1 110 3 RP063 Uncharacterized protein RP063 Rickettsia prowazekii (strain Madrid E)
P0A5B0 3.16e-20 82 42 0 92 1 BQ2027_MB2227C Protein Mb2227c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WMN5 3.16e-20 82 42 0 92 1 Rv2204c Protein Rv2204c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMN4 3.16e-20 82 42 0 92 3 MT2260 Protein MT2260 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q44540 5.52e-20 80 36 0 105 3 None Uncharacterized protein in nifU 5'region Azotobacter vinelandii
Q2TBG7 7.3e-20 82 48 1 83 2 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Bos taurus
Q47887 8.52e-20 81 39 1 109 3 None Uncharacterized protein in nifB-nifU intergenic region Frankia alni
Q5R788 1.05e-19 81 48 1 83 2 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Pongo abelii
Q86U28 1.19e-19 81 48 1 83 1 ISCA2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Homo sapiens
P44672 1.68e-19 79 41 4 110 3 iscA Iron-binding protein IscA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9DCB8 2.02e-19 80 46 1 83 1 Isca2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Mus musculus
C5BEU3 4.76e-19 78 40 4 110 3 iscA Iron-binding protein IscA Edwardsiella ictaluri (strain 93-146)
P72731 4.94e-19 79 38 2 112 3 slr1417 Uncharacterized protein slr1417 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
C6DBI9 1.23e-18 77 40 4 110 3 iscA Iron-binding protein IscA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D261 1.79e-18 77 41 4 110 3 iscA Iron-binding protein IscA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q07184 3.14e-18 76 32 0 104 3 None Uncharacterized protein in nifU 5'region Rhodobacter capsulatus
Q8LBM4 3.4e-18 77 35 1 104 2 At2g16710 Iron-sulfur assembly protein IscA-like 1, mitochondrial Arabidopsis thaliana
Q8LCY2 5.76e-18 77 39 2 107 1 At5g03905 Iron-sulfur assembly protein IscA-like 2, mitochondrial Arabidopsis thaliana
B4EZU6 5.86e-18 75 41 5 111 3 iscA Iron-binding protein IscA Proteus mirabilis (strain HI4320)
B1JRZ0 6.18e-18 75 39 4 110 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667Y3 6.18e-18 75 39 4 110 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TMV2 6.18e-18 75 39 4 110 3 iscA Iron-binding protein IscA Yersinia pestis (strain Pestoides F)
Q1CKA7 6.18e-18 75 39 4 110 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R816 6.18e-18 75 39 4 110 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZCS3 6.18e-18 75 39 4 110 3 iscA Iron-binding protein IscA Yersinia pestis
B2K9R5 6.18e-18 75 39 4 110 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C5H2 6.18e-18 75 39 4 110 3 iscA Iron-binding protein IscA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFX3 6.18e-18 75 39 4 110 3 iscA Iron-binding protein IscA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P37029 6.65e-18 75 37 0 104 3 blr1755 Uncharacterized protein blr1755 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A8GHY1 8.11e-18 75 39 4 110 3 iscA Iron-binding protein IscA Serratia proteamaculans (strain 568)
Q8L8C0 1.36e-17 75 34 2 105 3 At2g36260 Iron-sulfur assembly protein IscA-like 3, mitochondrial Arabidopsis thaliana
O43045 1.44e-17 77 35 2 115 3 isa2 Iron-sulfur assembly protein 2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A1JKQ4 2.13e-17 74 38 4 110 3 iscA Iron-binding protein IscA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q9XIK3 3.05e-17 75 41 1 93 2 ISCA Iron-sulfur assembly protein IscA, chloroplastic Arabidopsis thaliana
P46052 3.6e-17 74 38 2 110 2 hesB2 Protein HesB, vegetative Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A7MGY0 4.37e-17 73 41 4 110 3 iscA Iron-binding protein IscA Cronobacter sakazakii (strain ATCC BAA-894)
Q8GLE6 5.25e-17 73 37 4 110 3 iscA Iron-binding protein IscA Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
Q7N226 9.33e-17 72 38 4 110 3 iscA Iron-binding protein IscA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3YZ24 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Shigella sonnei (strain Ss046)
P0AAD1 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Shigella flexneri
Q32D36 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Shigella dysenteriae serotype 1 (strain Sd197)
Q31XW2 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Shigella boydii serotype 4 (strain Sb227)
B7LKB1 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LNI4 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain SMS-3-5 / SECEC)
B6I5A0 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain SE11)
B7N6B5 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AAC8 9.43e-17 72 40 4 110 1 iscA Iron-binding protein IscA Escherichia coli (strain K12)
B1IWD3 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AAC9 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEV7 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AE65 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli O1:K1 / APEC
B1XB03 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain K12 / DH10B)
C4ZXA3 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M7N1 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli O8 (strain IAI1)
B7MYG2 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli O81 (strain ED1a)
B7NRH7 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0AAD0 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli O157:H7
B7LDC0 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli (strain 55989 / EAEC)
B7MIL8 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGX4 9.43e-17 72 40 4 110 3 iscA Iron-binding protein IscA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P74596 1.05e-16 72 37 0 105 1 slr1565 Uncharacterized protein slr1565 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P46045 1.29e-16 74 40 0 97 3 nifU Nitrogen fixation protein NifU Frankia alni
Q54P40 1.41e-16 74 31 1 107 3 isca2 Iron-sulfur cluster assembly 2 homolog, mitochondrial Dictyostelium discoideum
B4T0S0 1.62e-16 72 40 4 110 3 iscA Iron-binding protein IscA Salmonella newport (strain SL254)
A6TCE9 4.5e-16 70 40 4 110 3 iscA Iron-binding protein IscA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q1XDR9 4.86e-16 71 41 2 107 3 ycf83 Uncharacterized protein ycf83 Neopyropia yezoensis
Q7CQ12 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFZ8 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella typhi
B4TRX3 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella schwarzengrund (strain CVM19633)
B5BAW8 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella paratyphi A (strain AKU_12601)
C0PYK9 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella paratyphi C (strain RKS4594)
A9N1X7 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PNG5 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TDB4 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella heidelberg (strain SL476)
B5RD10 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5A0 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella enteritidis PT4 (strain P125109)
B5FR83 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella dublin (strain CT_02021853)
Q57LH1 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella choleraesuis (strain SC-B67)
A9MHJ6 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F1B8 5.18e-16 70 40 4 110 3 iscA Iron-binding protein IscA Salmonella agona (strain SL483)
B5XNJ9 6.57e-16 70 40 4 110 3 iscA Iron-binding protein IscA Klebsiella pneumoniae (strain 342)
Q9MSA1 1.08e-15 70 36 1 107 3 ycf83 Uncharacterized protein ycf83 Galdieria sulphuraria
P46053 2.6e-15 69 33 1 109 3 hesB Protein HesB Leptolyngbya boryana
Q5ZJ74 4.43e-15 68 33 1 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Gallus gallus
A4WDA9 4.88e-15 68 39 4 110 3 iscA Iron-binding protein IscA Enterobacter sp. (strain 638)
A0A146B130 5.41e-15 69 33 2 115 2 SufA Iron-sulfur cluster assembly protein SufA Plasmodium vivax
Q80W96 6.06e-15 68 33 1 106 2 Isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Rattus norvegicus
Q9D924 8.38e-15 68 33 1 106 2 Isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Mus musculus
P78859 8.99e-15 69 30 0 105 2 isa1 Iron-sulfur assembly protein 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P0DN75 9.27e-15 68 33 1 106 1 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Columba livia
Q07821 1.21e-14 70 33 2 106 1 ISA1 Iron-sulfur assembly protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q54VS1 1.33e-14 68 37 2 107 3 isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Dictyostelium discoideum
Q4R5F0 2.49e-14 67 33 1 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Macaca fascicularis
Q9BUE6 2.49e-14 67 33 1 106 1 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Homo sapiens
Q3SZG8 2.49e-14 67 33 1 106 2 ISCA1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Bos taurus
P18501 4.09e-14 66 33 2 112 3 hesB Protein HesB Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8T3X9 1.42e-13 65 33 2 107 1 MagR Iron-sulfur cluster assembly 1 homolog, mitochondrial Drosophila melanogaster
P51217 1.45e-13 64 38 2 107 3 ycf83 Uncharacterized protein ycf83 Porphyra purpurea
Q43895 2.15e-13 64 37 2 106 3 None Uncharacterized protein in nifU 5'region Azospirillum brasilense
A0A509ANY8 2.66e-13 65 31 1 110 1 SufA Iron-sulfur cluster assembly protein SufA Plasmodium berghei (strain Anka)
P46051 3.13e-13 64 33 2 110 2 hesB1 Protein HesB, heterocyst Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q4QRC6 1.33e-12 62 33 1 106 2 isca1 Iron-sulfur cluster assembly 1 homolog, mitochondrial Danio rerio
Q8I3N6 3.63e-11 60 30 2 110 1 SufA Iron-sulfur cluster assembly protein SufA Plasmodium falciparum (isolate 3D7)
Q12425 5.31e-09 54 29 3 123 1 ISA2 Iron-sulfur assembly protein 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P77667 1.53e-08 52 31 3 107 1 sufA Iron-sulfur cluster assembly protein SufA Escherichia coli (strain K12)
B4EZM8 1.36e-06 48 29 2 97 3 nfuA Fe/S biogenesis protein NfuA Proteus mirabilis (strain HI4320)
Q8KA13 1.42e-06 47 28 4 112 3 BUsg_114 Uncharacterized protein BUsg_114 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q7VNV0 7.3e-06 46 22 2 105 3 nfuA Fe/S biogenesis protein NfuA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q2NQH5 1.78e-05 45 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Sodalis glossinidius (strain morsitans)
B0BS54 1.92e-05 45 24 2 105 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZZ1 1.92e-05 45 24 2 105 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYM1 1.92e-05 45 24 2 105 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6TF37 2.31e-05 44 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTS2 2.31e-05 44 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Klebsiella pneumoniae (strain 342)
C6DH68 3.29e-05 44 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZL7 4.18e-05 43 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4ST19 5.53e-05 43 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Aeromonas salmonicida (strain A449)
C5BGT5 5.83e-05 43 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Edwardsiella ictaluri (strain 93-146)
B1JHZ3 7.65e-05 43 28 2 95 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664J6 7.65e-05 43 28 2 95 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGR7 7.65e-05 43 28 2 95 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis (strain Pestoides F)
Q1CCL5 7.65e-05 43 28 2 95 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4D2 7.65e-05 43 28 2 95 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJI0 7.65e-05 43 28 2 95 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis
B2K5V9 7.65e-05 43 28 2 95 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2L8 7.65e-05 43 28 2 95 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNW0 7.65e-05 43 28 2 95 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A0KF09 0.000105 42 26 3 98 3 nfuA Fe/S biogenesis protein NfuA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q12IC3 0.000115 42 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q15N06 0.000117 42 29 2 92 3 nfuA Fe/S biogenesis protein NfuA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B4S1U9 0.000162 42 32 2 93 3 nfuA Fe/S biogenesis protein NfuA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A9KUY3 0.000168 42 28 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS195)
A6WU19 0.000168 42 28 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS185)
A3CYW3 0.000168 42 28 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8ECN4 0.000168 42 28 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS223)
Q0HDK0 0.000229 42 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain MR-4)
A0L2F1 0.000229 42 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain ANA-3)
B1KM47 0.000249 42 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella woodyi (strain ATCC 51908 / MS32)
Q0HPU8 0.000251 41 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain MR-7)
A8FPL9 0.000298 41 27 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella sediminis (strain HAW-EB3)
A1JSF6 0.000368 41 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A1SBE8 0.000648 40 30 2 92 3 nfuA Fe/S biogenesis protein NfuA Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8GKT7 0.000684 40 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Serratia proteamaculans (strain 568)
Q7N9W2 0.000771 40 25 2 97 3 nfuA Fe/S biogenesis protein NfuA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1RE77 0.000814 40 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain W3-18-1)
A4YC18 0.000814 40 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A3Q930 0.000822 40 26 2 97 3 nfuA Fe/S biogenesis protein NfuA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q5QZC8 0.000831 40 26 2 98 3 nfuA Fe/S biogenesis protein NfuA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_08025
Feature type CDS
Gene erpA
Product iron-sulfur cluster insertion protein ErpA
Location 5536 - 5880 (strand: -1)
Length 345 (nucleotides) / 114 (amino acids)
In genomic island -

Contig

Accession ZDB_685
Length 192328 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1372
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01521 Iron-sulphur cluster biosynthesis

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0316 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster assembly iron-binding protein IscA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15724 iron-sulfur cluster insertion protein - -

Protein Sequence

MSDDSAMPLQFTDAAAKKVKILIADEENPNLRLRVYITGGGCSGFQYGFTFDDAINDGDMTIEKEGVALVVDPMSLQYLVGGCVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI

Flanking regions ( +/- flanking 50bp)

CGGTCAGCTTCTGCGTGTGTTTACTGGTCGCGGCCAGTCTGGAGTAATAAATGAGCGATGATTCAGCAATGCCCCTGCAATTTACTGATGCGGCAGCTAAAAAAGTAAAAATCTTAATTGCGGATGAAGAAAATCCGAACCTGCGTCTGCGTGTGTATATCACCGGCGGCGGTTGCAGCGGTTTCCAGTATGGCTTCACGTTTGATGATGCCATCAATGACGGCGACATGACCATCGAAAAAGAAGGCGTGGCGCTGGTGGTTGATCCGATGAGCCTGCAATATCTGGTCGGCGGTTGTGTGGATTATACCGAAGGGCTGGAAGGCTCGCGGTTTATCGTCACCAACCCGAATGCCAAAACAACCTGTGGCTGTGGTTCTTCTTTCAGTATCTGATTTATCCGCAGACAAAAAACGGGCGCTTTTGCGCCCGTTTTGTTTTTATG