Homologs in group_1366

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08020 FBDBKF_08020 97.4 Morganella morganii S1 dksA RNA polymerase-binding protein DksA
EHELCC_13850 EHELCC_13850 97.4 Morganella morganii S2 dksA RNA polymerase-binding protein DksA
NLDBIP_14295 NLDBIP_14295 97.4 Morganella morganii S4 dksA RNA polymerase-binding protein DksA
LHKJJB_08555 LHKJJB_08555 97.4 Morganella morganii S3 dksA RNA polymerase-binding protein DksA
HKOGLL_08105 HKOGLL_08105 97.4 Morganella morganii S5 dksA RNA polymerase-binding protein DksA
F4V73_RS12970 F4V73_RS12970 95.4 Morganella psychrotolerans dksA RNA polymerase-binding protein DksA

Distribution of the homologs in the orthogroup group_1366

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1366

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1G5 9.31e-105 298 94 0 151 3 dksA RNA polymerase-binding transcription factor DksA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1G6 9.31e-105 298 94 0 151 3 dksA RNA polymerase-binding transcription factor DksA Salmonella typhi
P0ABS4 9.62e-105 298 94 0 151 3 dksA RNA polymerase-binding transcription factor DksA Shigella flexneri
P0ABS1 9.62e-105 298 94 0 151 1 dksA RNA polymerase-binding transcription factor DksA Escherichia coli (strain K12)
P0ABS2 9.62e-105 298 94 0 151 3 dksA RNA polymerase-binding transcription factor DksA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABS3 9.62e-105 298 94 0 151 3 dksA RNA polymerase-binding transcription factor DksA Escherichia coli O157:H7
Q8K9U5 2.4e-83 244 72 0 151 3 dksA RNA polymerase-binding transcription factor DksA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57294 1.97e-79 234 69 0 151 3 dksA RNA polymerase-binding transcription factor DksA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q89AR3 2.57e-76 226 67 0 151 3 dksA RNA polymerase-binding transcription factor DksA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P43758 2.42e-75 224 73 0 142 3 dksA RNA polymerase-binding transcription factor DksA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B8H0C0 1.25e-31 113 44 1 126 3 dksA RNA polymerase-binding transcription factor DksA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAU3 1.25e-31 113 44 1 126 3 dksA RNA polymerase-binding transcription factor DksA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P42408 1.68e-05 46 31 7 138 4 yteA Uncharacterized protein YteA Bacillus subtilis (strain 168)
P80872 0.000326 42 35 0 48 1 yocK General stress protein 16O Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00965
Feature type CDS
Gene dksA
Product RNA polymerase-binding protein DksA
Location 236089 - 236544 (strand: -1)
Length 456 (nucleotides) / 151 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1366
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01258 Prokaryotic dksA/traR C4-type zinc finger
PF21157 DnaK suppressor protein DksA, N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1734 Transcription (K) K RNA polymerase-binding transcription factor DksA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06204 RNA polymerase-binding transcription factor Biofilm formation - Escherichia coli -

Protein Sequence

MQEGQKRKTSSMSILAIAGVEPYQEKPGEEYMNEAQLAHFKLILESWRNQLRDEVNRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDDDFGFCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG

Flanking regions ( +/- flanking 50bp)

CTATTTAAGGTGGGGGATTATTCAGAAAATGCGTATGTAGGAGAAGCATTATGCAAGAAGGGCAAAAGCGTAAAACATCGTCCATGAGCATTCTCGCTATTGCTGGCGTTGAGCCATATCAGGAAAAACCGGGCGAAGAGTACATGAACGAAGCCCAATTAGCGCATTTTAAGCTAATACTTGAATCTTGGCGCAATCAGCTCAGGGATGAAGTCAACCGTACCGTCACTCATATGCAAGATGAGGCGGCCAACTTCCCAGATCCTGTTGACCGTGCTGCACAAGAAGAAGAATTCAGTCTTGAGCTGCGTAACCGTGATCGTGAACGTAAACTCATAAAGAAAATTGAGAAAACACTGAAGAAAGTTGAAGATGATGACTTCGGCTTTTGTGAGTCTTGCGGTGTTGAAATCGGCATCCGCCGTTTAGAAGCTCGTCCAACAGCCGATCTCTGTATCGACTGTAAAACATTAGCTGAAATCCGTGAAAAACAGATGGCTGGCTAATTAATGAGTATAGCCTCAGTACTTAGGTGCTGGGGCTTTAATCTAAACAT