Homologs in group_1309

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08020 FBDBKF_08020 98.0 Morganella morganii S1 dksA RNA polymerase-binding protein DksA
EHELCC_13850 EHELCC_13850 98.0 Morganella morganii S2 dksA RNA polymerase-binding protein DksA
NLDBIP_14295 NLDBIP_14295 98.0 Morganella morganii S4 dksA RNA polymerase-binding protein DksA
LHKJJB_08555 LHKJJB_08555 98.0 Morganella morganii S3 dksA RNA polymerase-binding protein DksA
HKOGLL_08105 HKOGLL_08105 98.0 Morganella morganii S5 dksA RNA polymerase-binding protein DksA
PMI_RS00965 PMI_RS00965 95.4 Proteus mirabilis HI4320 dksA RNA polymerase-binding protein DksA

Distribution of the homologs in the orthogroup group_1309

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1309

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1G5 3.2e-102 292 93 0 151 3 dksA RNA polymerase-binding transcription factor DksA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1G6 3.2e-102 292 93 0 151 3 dksA RNA polymerase-binding transcription factor DksA Salmonella typhi
P0ABS4 3.85e-102 291 93 0 151 3 dksA RNA polymerase-binding transcription factor DksA Shigella flexneri
P0ABS1 3.85e-102 291 93 0 151 1 dksA RNA polymerase-binding transcription factor DksA Escherichia coli (strain K12)
P0ABS2 3.85e-102 291 93 0 151 3 dksA RNA polymerase-binding transcription factor DksA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABS3 3.85e-102 291 93 0 151 3 dksA RNA polymerase-binding transcription factor DksA Escherichia coli O157:H7
Q8K9U5 3.45e-81 239 70 0 151 3 dksA RNA polymerase-binding transcription factor DksA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AR3 5.3e-78 231 68 0 151 3 dksA RNA polymerase-binding transcription factor DksA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P57294 7.94e-78 230 68 0 151 3 dksA RNA polymerase-binding transcription factor DksA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P43758 4.19e-74 221 72 0 142 3 dksA RNA polymerase-binding transcription factor DksA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B8H0C0 5.13e-32 114 47 0 117 3 dksA RNA polymerase-binding transcription factor DksA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAU3 5.13e-32 114 47 0 117 3 dksA RNA polymerase-binding transcription factor DksA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P42408 2.43e-05 45 35 3 84 4 yteA Uncharacterized protein YteA Bacillus subtilis (strain 168)
P80872 0.0001 43 37 0 48 1 yocK General stress protein 16O Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12970
Feature type CDS
Gene dksA
Product RNA polymerase-binding protein DksA
Location 206704 - 207159 (strand: 1)
Length 456 (nucleotides) / 151 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1309
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01258 Prokaryotic dksA/traR C4-type zinc finger
PF21157 DnaK suppressor protein DksA, N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1734 Transcription (K) K RNA polymerase-binding transcription factor DksA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06204 RNA polymerase-binding transcription factor Biofilm formation - Escherichia coli -

Protein Sequence

MQEGQKRKTSSLSILAIAGVEPYHEKAGEEYMNTAQLAHFKLILEAWRNQLRDEVGRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDDDFGFCESCGVEIGIRRLEARPTADMCIDCKTLAEIREKQMAG

Flanking regions ( +/- flanking 50bp)

TTTTCCCCTCTAAGGGATATTGTCAGACATGCGTGTGTAGGAGAAGCATTATGCAGGAAGGGCAAAAACGTAAAACCTCGTCCCTGAGCATTCTTGCCATTGCCGGCGTTGAGCCGTATCACGAAAAAGCAGGCGAAGAATACATGAATACCGCTCAGTTGGCCCATTTCAAGTTAATACTTGAAGCATGGCGCAACCAGCTGAGAGACGAAGTCGGCCGTACTGTTACCCACATGCAGGATGAAGCAGCAAACTTCCCGGACCCGGTCGACCGCGCGGCTCAGGAAGAAGAATTCAGCCTGGAACTTCGTAACCGTGACCGCGAACGAAAACTGATCAAAAAAATCGAAAAAACCCTCAAGAAGGTTGAGGACGACGATTTTGGTTTTTGTGAGTCCTGCGGAGTCGAGATCGGGATCCGCCGCTTAGAAGCGCGCCCGACCGCAGATATGTGTATCGACTGTAAAACATTAGCTGAAATCCGCGAAAAGCAGATGGCAGGCTGATACATTATTTACCACGGACGGCGCTTTACAGCGCCGTCCGTTTTTATTTT