Homologs in group_787

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03685 FBDBKF_03685 69.2 Morganella morganii S1 ybdD DUF466 domain-containing protein
EHELCC_06850 EHELCC_06850 69.2 Morganella morganii S2 ybdD DUF466 domain-containing protein
NLDBIP_07175 NLDBIP_07175 69.2 Morganella morganii S4 ybdD DUF466 domain-containing protein
LHKJJB_06710 LHKJJB_06710 69.2 Morganella morganii S3 ybdD DUF466 domain-containing protein
HKOGLL_04220 HKOGLL_04220 69.2 Morganella morganii S5 ybdD DUF466 domain-containing protein
F4V73_RS11185 F4V73_RS11185 67.7 Morganella psychrotolerans - YbdD/YjiX family protein

Distribution of the homologs in the orthogroup group_787

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_787

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADD1 4.59e-37 120 85 1 68 4 yjiX Uncharacterized protein YjiX Shigella flexneri
P0ADC8 4.59e-37 120 85 1 68 4 yjiX Uncharacterized protein YjiX Escherichia coli (strain K12)
P0ADC9 4.59e-37 120 85 1 68 4 yjiX Uncharacterized protein YjiX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADD0 4.59e-37 120 85 1 68 4 yjiX Uncharacterized protein YjiX Escherichia coli O157:H7
P0AAT1 2.9e-30 103 70 1 68 4 ybdD Uncharacterized protein YbdD Shigella flexneri
P0AAS9 2.9e-30 103 70 1 68 4 ybdD Uncharacterized protein YbdD Escherichia coli (strain K12)
P0AAT0 2.9e-30 103 70 1 68 4 ybdD Uncharacterized protein YbdD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00690
Feature type CDS
Gene -
Product YbdD/YjiX family protein
Location 178215 - 178421 (strand: 1)
Length 207 (nucleotides) / 68 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_787
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04328 Selenoprotein, putative

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2879 Function unknown (S) S Uncharacterized short protein YbdD, DUF466 family

Protein Sequence

MFGNLGQAGKYLGQAARMLIGIPDYDNYVQHMKDNHPDKPVMTYNEFFRERQEARYGGGDGKGGFRCC

Flanking regions ( +/- flanking 50bp)

GCTAAAAACCCCCGCACTCACTTAATGAGTGCGGGGCTTAGGAGAAACTTATGTTTGGTAATTTAGGGCAAGCTGGAAAATATCTAGGACAAGCCGCTCGTATGTTAATAGGTATTCCTGATTATGATAACTATGTGCAGCACATGAAGGACAACCATCCTGATAAACCAGTGATGACCTATAACGAGTTTTTCCGTGAACGTCAGGAAGCCCGTTATGGTGGCGGTGATGGTAAAGGTGGTTTCCGCTGTTGCTAATAATCTGTAAAGGAGACAAATAATGGAACCTATTGCAGTAACAATATTGA