Homologs in group_856

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03685 FBDBKF_03685 100.0 Morganella morganii S1 ybdD DUF466 domain-containing protein
NLDBIP_07175 NLDBIP_07175 100.0 Morganella morganii S4 ybdD DUF466 domain-containing protein
LHKJJB_06710 LHKJJB_06710 100.0 Morganella morganii S3 ybdD DUF466 domain-containing protein
HKOGLL_04220 HKOGLL_04220 100.0 Morganella morganii S5 ybdD DUF466 domain-containing protein
F4V73_RS11185 F4V73_RS11185 98.5 Morganella psychrotolerans - YbdD/YjiX family protein
PMI_RS00690 PMI_RS00690 69.2 Proteus mirabilis HI4320 - YbdD/YjiX family protein

Distribution of the homologs in the orthogroup group_856

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_856

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAT1 8.26e-37 120 80 0 65 4 ybdD Uncharacterized protein YbdD Shigella flexneri
P0AAS9 8.26e-37 120 80 0 65 4 ybdD Uncharacterized protein YbdD Escherichia coli (strain K12)
P0AAT0 8.26e-37 120 80 0 65 4 ybdD Uncharacterized protein YbdD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADD1 5.26e-28 98 65 1 67 4 yjiX Uncharacterized protein YjiX Shigella flexneri
P0ADC8 5.26e-28 98 65 1 67 4 yjiX Uncharacterized protein YjiX Escherichia coli (strain K12)
P0ADC9 5.26e-28 98 65 1 67 4 yjiX Uncharacterized protein YjiX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADD0 5.26e-28 98 65 1 67 4 yjiX Uncharacterized protein YjiX Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_06850
Feature type CDS
Gene ybdD
Product DUF466 domain-containing protein
Location 105435 - 105632 (strand: -1)
Length 198 (nucleotides) / 65 (amino acids)
In genomic island -

Contig

Accession ZDB_216
Length 269970 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_856
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04328 Selenoprotein, putative

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2879 Function unknown (S) S Uncharacterized short protein YbdD, DUF466 family

Protein Sequence

MFDTLAKAGRYLGQTAKMMIGVPDYDNYVQHMKNTHPDQTPMTYEEFFRDRQDARYGSKGGPKCC

Flanking regions ( +/- flanking 50bp)

CGGCAGGCAACTGCCGCTCCTCCGTACGCAACAGGTTCAGGGTCATAATTATGTTTGATACTCTCGCAAAAGCAGGACGTTATCTCGGTCAGACCGCCAAAATGATGATTGGTGTGCCGGATTACGATAACTATGTACAACACATGAAAAACACCCATCCTGATCAGACACCGATGACCTATGAAGAGTTTTTCCGCGATCGTCAGGATGCCCGTTACGGCAGCAAAGGCGGCCCGAAATGCTGCTGAGCCGCACAACGGCAATCATGTAAAAATACCGCACTGATTGCGGTATTTTT