Homologs in group_2101

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15820 FBDBKF_15820 85.7 Morganella morganii S1 cyoE heme o synthase
EHELCC_18420 EHELCC_18420 85.7 Morganella morganii S2 cyoE heme o synthase
NLDBIP_17255 NLDBIP_17255 85.7 Morganella morganii S4 cyoE heme o synthase
LHKJJB_17405 LHKJJB_17405 85.7 Morganella morganii S3 cyoE heme o synthase
HKOGLL_16990 HKOGLL_16990 85.7 Morganella morganii S5 cyoE heme o synthase
F4V73_RS16490 F4V73_RS16490 86.4 Morganella psychrotolerans cyoE heme o synthase

Distribution of the homologs in the orthogroup group_2101

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2101

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JNP6 0.0 508 87 1 288 3 cyoE Protoheme IX farnesyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7N0K3 2.53e-178 496 85 0 294 3 cyoE Protoheme IX farnesyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66DU5 1.01e-177 494 87 0 290 3 cyoE Protoheme IX farnesyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPF3 1.01e-177 494 87 0 290 3 cyoE Protoheme IX farnesyltransferase Yersinia pestis (strain Pestoides F)
Q1CL75 1.01e-177 494 87 0 290 3 cyoE Protoheme IX farnesyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WCB5 1.01e-177 494 87 0 290 3 cyoE Protoheme IX farnesyltransferase Yersinia pestis
Q1C4J8 1.01e-177 494 87 0 290 3 cyoE Protoheme IX farnesyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
B1JHT2 1.12e-177 494 87 0 290 3 cyoE Protoheme IX farnesyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FLD4 1.12e-177 494 87 0 290 3 cyoE Protoheme IX farnesyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VHR9 5.41e-177 493 81 1 294 3 cyoE Protoheme IX farnesyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GAQ0 4.5e-176 490 81 1 295 3 cyoE Protoheme IX farnesyltransferase Serratia proteamaculans (strain 568)
C6DB46 3.61e-174 486 81 2 296 3 cyoE Protoheme IX farnesyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D836 3.61e-174 486 81 2 296 3 cyoE Protoheme IX farnesyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MFG8 1.27e-173 484 84 0 281 3 cyoE Protoheme IX farnesyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
Q2NV87 5.31e-173 483 82 2 295 3 cyoE Protoheme IX farnesyltransferase Sodalis glossinidius (strain morsitans)
C5BFX0 6.66e-173 483 81 0 288 3 cyoE Protoheme IX farnesyltransferase Edwardsiella ictaluri (strain 93-146)
A6T5H1 2.05e-172 481 80 1 295 3 cyoE Protoheme IX farnesyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q325H3 4.93e-170 475 81 1 289 3 cyoE Protoheme IX farnesyltransferase Shigella boydii serotype 4 (strain Sb227)
B1LJI2 4.93e-170 475 81 1 289 3 cyoE Protoheme IX farnesyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
P0AEA5 4.93e-170 475 81 1 289 1 cyoE Protoheme IX farnesyltransferase Escherichia coli (strain K12)
B1J021 4.93e-170 475 81 1 289 3 cyoE Protoheme IX farnesyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AEA6 4.93e-170 475 81 1 289 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZX84 4.93e-170 475 81 1 289 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O9:H4 (strain HS)
B1XFL6 4.93e-170 475 81 1 289 3 cyoE Protoheme IX farnesyltransferase Escherichia coli (strain K12 / DH10B)
P0AEA7 4.93e-170 475 81 1 289 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O157:H7
A7ZII5 4.93e-170 475 81 1 289 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8Z8V5 7.99e-170 474 80 1 294 3 cyoE Protoheme IX farnesyltransferase Salmonella typhi
Q8ZRC4 1.19e-169 474 79 1 294 3 cyoE Protoheme IX farnesyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFP5 1.19e-169 474 79 1 294 3 cyoE Protoheme IX farnesyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57SC4 1.19e-169 474 79 1 294 3 cyoE Protoheme IX farnesyltransferase Salmonella choleraesuis (strain SC-B67)
A9MWZ0 1.36e-169 474 79 1 294 3 cyoE Protoheme IX farnesyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q3Z4X5 1.98e-169 474 80 1 289 3 cyoE Protoheme IX farnesyltransferase Shigella sonnei (strain Ss046)
Q1RFB2 2.61e-169 473 81 1 287 3 cyoE Protoheme IX farnesyltransferase Escherichia coli (strain UTI89 / UPEC)
Q0TKL4 2.61e-169 473 81 1 287 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A897 2.61e-169 473 81 1 287 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O1:K1 / APEC
Q83SF7 7.55e-169 472 80 1 289 3 cyoE Protoheme IX farnesyltransferase Shigella flexneri
A9MM32 2.41e-168 471 78 1 294 3 cyoE Protoheme IX farnesyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AK26 3.58e-168 471 82 0 281 3 cyoE Protoheme IX farnesyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4W799 9.78e-168 469 81 0 281 3 cyoE Protoheme IX farnesyltransferase Enterobacter sp. (strain 638)
A4SPY8 5.54e-157 442 80 1 290 3 cyoE Protoheme IX farnesyltransferase Aeromonas salmonicida (strain A449)
A0KME5 8.61e-157 442 80 1 287 3 cyoE Protoheme IX farnesyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q4K6M1 3.64e-145 412 69 0 291 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q887G7 1.83e-143 408 67 0 291 3 cyoE Protoheme IX farnesyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZXC3 3.07e-143 407 67 0 291 3 cyoE Protoheme IX farnesyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q48M92 4.12e-143 407 67 0 291 3 cyoE Protoheme IX farnesyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3K773 5.42e-143 407 68 0 291 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas fluorescens (strain Pf0-1)
Q1H1S8 2.87e-142 405 70 0 280 3 ctaB Protoheme IX farnesyltransferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q1QYZ3 4.49e-140 399 64 1 295 3 cyoE Protoheme IX farnesyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1IEP0 1.14e-139 398 64 0 293 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas entomophila (strain L48)
Q9WWR5 1.33e-139 398 64 0 293 3 cyoE Protoheme IX farnesyltransferase Pseudomonas putida
Q88PN3 1.99e-139 398 64 0 293 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KPE4 1.99e-139 398 64 0 293 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas putida (strain GB-1)
A5VYP1 1.99e-139 398 64 0 293 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1JDU9 4.01e-139 397 64 0 293 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas putida (strain W619)
Q7NQZ3 1.79e-136 390 67 1 287 3 ctaB2 Protoheme IX farnesyltransferase 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9I423 1.09e-131 378 66 0 280 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02JG2 1.09e-131 378 66 0 280 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V8N8 1.21e-130 375 65 0 280 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas aeruginosa (strain PA7)
Q1LTJ4 2.16e-122 354 61 2 283 3 cyoE Protoheme IX farnesyltransferase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3IHM5 1.71e-119 347 61 1 292 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudoalteromonas translucida (strain TAC 125)
A6VRF6 2.72e-119 347 59 1 293 3 cyoE Protoheme IX farnesyltransferase Marinomonas sp. (strain MWYL1)
Q089I2 3.2e-119 347 60 1 281 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella frigidimarina (strain NCIMB 400)
A6WU49 5.62e-116 339 60 1 280 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella baltica (strain OS185)
Q0HDH7 6.06e-116 339 58 1 289 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella sp. (strain MR-4)
A0L2I3 6.62e-116 338 58 1 289 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella sp. (strain ANA-3)
A1RE49 7.11e-116 339 58 1 289 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella sp. (strain W3-18-1)
Q0HPR0 1.45e-115 338 58 1 289 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella sp. (strain MR-7)
Q15WB8 1.46e-115 337 60 1 281 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A4YC85 2.61e-115 337 58 1 289 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KV13 1.93e-113 332 60 1 275 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella baltica (strain OS195)
B1KQ72 4.63e-113 331 60 1 273 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella woodyi (strain ATCC 51908 / MS32)
A3Q9U4 9.13e-110 323 58 1 278 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q493G3 3.38e-101 301 53 2 266 3 cyoE Protoheme IX farnesyltransferase Blochmanniella pennsylvanica (strain BPEN)
Q6MBY2 9.56e-99 294 50 1 281 3 ctaB Protoheme IX farnesyltransferase Protochlamydia amoebophila (strain UWE25)
Q7VRH6 3.39e-93 280 48 3 286 3 cyoE Protoheme IX farnesyltransferase Blochmanniella floridana
Q6F9R1 2.02e-92 278 48 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B6EQE1 2.35e-89 270 47 1 282 3 cyoE Protoheme IX farnesyltransferase Aliivibrio salmonicida (strain LFI1238)
Q8D350 7.89e-89 269 50 2 284 3 cyoE Protoheme IX farnesyltransferase Wigglesworthia glossinidia brevipalpis
Q87IH5 1.02e-87 266 47 1 282 3 cyoE2 Protoheme IX farnesyltransferase 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0V7G8 3.03e-86 263 50 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baumannii (strain AYE)
A3M6Q3 3.03e-86 263 50 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VM11 3.03e-86 263 50 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baumannii (strain SDF)
B7IBC0 3.03e-86 263 50 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baumannii (strain AB0057)
B7H0K1 3.03e-86 263 50 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baumannii (strain AB307-0294)
A7N2M2 6.11e-82 251 46 1 282 3 cyoE1 Protoheme IX farnesyltransferase 1 Vibrio campbellii (strain ATCC BAA-1116)
B8D7Z7 3.79e-78 242 47 3 283 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57540 3.79e-78 242 47 3 283 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9P5 3.79e-78 242 47 3 283 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A7N9N4 3.2e-74 231 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IZX0 6.07e-74 231 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BNW5 6.07e-74 231 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4E4 6.07e-74 231 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. novicida (strain U112)
Q2A5L1 8.58e-74 231 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. holarctica (strain LVS)
Q8K997 6.5e-72 226 46 0 281 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q5NI07 6.66e-72 226 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JF9 6.66e-72 226 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. tularensis (strain FSC 198)
O31652 1.51e-64 208 38 4 290 1 ctaB1 Protoheme IX farnesyltransferase 1 Bacillus subtilis (strain 168)
Q89AA7 2.24e-62 201 41 0 273 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9K9M9 4.12e-62 201 38 4 283 3 ctaB Protoheme IX farnesyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q04444 7.75e-61 198 38 4 285 3 ctaB Protoheme IX farnesyltransferase Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q65K13 3.86e-58 191 38 4 285 3 ctaB Protoheme IX farnesyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q929W0 2.07e-57 189 39 4 286 3 ctaB Protoheme IX farnesyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y5K3 4.58e-57 188 38 4 286 3 ctaB Protoheme IX farnesyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DH72 4.74e-57 188 38 4 286 3 ctaB Protoheme IX farnesyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q71XV7 4.74e-57 188 38 4 286 3 ctaB Protoheme IX farnesyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KX10 4.74e-57 188 38 4 286 3 ctaB Protoheme IX farnesyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
A0AKG3 5.16e-57 188 39 4 286 3 ctaB Protoheme IX farnesyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
O66544 1.71e-56 186 38 1 280 3 ctaB Protoheme IX farnesyltransferase Aquifex aeolicus (strain VF5)
A7Z2K2 2.11e-55 184 36 3 287 3 ctaB1 Protoheme IX farnesyltransferase 1 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P24009 2.63e-55 184 37 4 273 1 ctaB2 Protoheme IX farnesyltransferase 2 Bacillus subtilis (strain 168)
A7Z4B1 4.09e-55 183 37 4 273 3 ctaB2 Protoheme IX farnesyltransferase 2 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B1HPV1 6.92e-55 183 38 4 282 3 ctaB1 Protoheme IX farnesyltransferase 1 Lysinibacillus sphaericus (strain C3-41)
Q057F2 1.24e-53 179 38 2 255 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
C5D862 1.28e-53 179 35 4 281 3 ctaB Protoheme IX farnesyltransferase Geobacillus sp. (strain WCH70)
Q8CXI8 1.91e-53 179 38 3 264 3 ctaB Protoheme IX farnesyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B1YIW5 8.58e-53 177 38 6 285 3 ctaB Protoheme IX farnesyltransferase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A9VUA6 1.05e-51 174 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus mycoides (strain KBAB4)
Q5L114 2.97e-51 174 39 5 284 3 ctaB Protoheme IX farnesyltransferase Geobacillus kaustophilus (strain HTA426)
A4ILX0 1.1e-50 172 38 5 284 3 ctaB Protoheme IX farnesyltransferase Geobacillus thermodenitrificans (strain NG80-2)
Q0VN94 1.35e-50 172 33 2 281 3 cyoE Protoheme IX farnesyltransferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B0TNS4 1.57e-50 171 35 1 279 3 cyoE Protoheme IX farnesyltransferase Shewanella halifaxensis (strain HAW-EB4)
Q8E8P7 2.39e-50 171 36 1 266 3 cyoE Protoheme IX farnesyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5X7X6 3.22e-50 170 38 1 266 3 cyoE Protoheme IX farnesyltransferase Legionella pneumophila (strain Paris)
Q5R0Y6 8.74e-50 169 34 1 279 3 cyoE Protoheme IX farnesyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9WT38 1.36e-49 169 35 2 284 3 ctaB Protoheme IX farnesyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q15N01 1.9e-49 169 35 1 267 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5ZYG0 3.37e-49 168 37 1 266 3 cyoE Protoheme IX farnesyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHI2 3.37e-49 168 37 1 266 3 cyoE Protoheme IX farnesyltransferase Legionella pneumophila (strain Corby)
A8FCU6 3.46e-49 168 34 4 283 3 ctaB Protoheme IX farnesyltransferase Bacillus pumilus (strain SAFR-032)
Q5WZC7 4.32e-49 167 37 1 266 3 cyoE Protoheme IX farnesyltransferase Legionella pneumophila (strain Lens)
Q0HDK5 7.45e-49 167 35 1 266 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella sp. (strain MR-4)
A4G936 9.54e-49 167 32 1 280 3 ctaB Protoheme IX farnesyltransferase Herminiimonas arsenicoxydans
A0L2E7 9.84e-49 167 35 1 266 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella sp. (strain ANA-3)
B7IVI2 1.37e-48 167 34 6 287 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain G9842)
Q114N4 1.6e-48 167 37 1 280 3 ctaB Protoheme IX farnesyltransferase Trichodesmium erythraeum (strain IMS101)
Q6HEL9 2.32e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q635Y1 2.32e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain ZK / E33L)
B7JK33 2.32e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain AH820)
Q81MT8 2.32e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus anthracis
C3LI11 2.32e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P6V2 2.32e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus anthracis (strain A0248)
A4VS42 2.35e-48 166 32 1 279 3 cyoE Protoheme IX farnesyltransferase Stutzerimonas stutzeri (strain A1501)
Q0HPV6 2.42e-48 166 36 0 238 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella sp. (strain MR-7)
C1EPV9 2.42e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain 03BB102)
A0RHW3 2.42e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus thuringiensis (strain Al Hakam)
Q819N1 2.5e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IW24 2.5e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain Q1)
B7HMC9 2.5e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain AH187)
B7H6T1 2.5e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain B4264)
Q732C2 2.5e-48 166 34 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q5WDX4 3.02e-48 166 37 5 275 3 ctaB Protoheme IX farnesyltransferase Shouchella clausii (strain KSM-K16)
A3CYW8 3.39e-48 165 35 1 266 3 cyoE Protoheme IX farnesyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9KUX8 3.39e-48 165 35 1 266 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella baltica (strain OS195)
A8H9S9 4.92e-48 165 34 2 284 3 cyoE Protoheme IX farnesyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A6WU15 6.57e-48 165 36 0 238 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella baltica (strain OS185)
A1R6I0 8.39e-48 165 34 1 284 3 ctaB Protoheme IX farnesyltransferase Paenarthrobacter aurescens (strain TC1)
A1RE84 9.66e-48 164 34 1 279 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella sp. (strain W3-18-1)
A7GRX3 1.4e-47 164 34 6 287 3 ctaB2 Protoheme IX farnesyltransferase 2 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A8EZ97 1.64e-47 164 33 3 268 3 ctaB Protoheme IX farnesyltransferase Rickettsia canadensis (strain McKiel)
A4YC13 1.8e-47 164 36 0 238 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q12IC7 2.35e-47 163 36 3 267 3 cyoE Protoheme IX farnesyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q21PS1 5.06e-47 162 32 1 279 3 cyoE Protoheme IX farnesyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8DHQ2 1.18e-46 162 34 1 279 3 ctaB Protoheme IX farnesyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q089F2 2.03e-46 161 33 2 284 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella frigidimarina (strain NCIMB 400)
Q48AB7 2.71e-46 160 33 0 245 3 cyoE Protoheme IX farnesyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A3Q941 4.09e-46 160 34 1 279 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q1LRS0 4.71e-46 160 34 1 281 3 ctaB Protoheme IX farnesyltransferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A1TWQ8 7.75e-46 159 33 1 279 3 cyoE Protoheme IX farnesyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A0JWQ8 1.01e-45 159 33 1 284 3 ctaB Protoheme IX farnesyltransferase Arthrobacter sp. (strain FB24)
B1YN86 1.06e-45 159 34 3 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia ambifaria (strain MC40-6)
B1HST2 1.24e-45 159 38 6 275 3 ctaB2 Protoheme IX farnesyltransferase 2 Lysinibacillus sphaericus (strain C3-41)
Q0ABY1 2.65e-45 158 34 1 279 3 cyoE Protoheme IX farnesyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C5BKU5 2.77e-45 158 33 1 279 3 cyoE Protoheme IX farnesyltransferase Teredinibacter turnerae (strain ATCC 39867 / T7901)
B2AGR8 5.07e-45 157 34 1 281 3 ctaB Protoheme IX farnesyltransferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0BBM3 5.42e-45 157 33 3 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B8GPF3 5.89e-45 157 32 1 279 3 cyoE Protoheme IX farnesyltransferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q2SQU8 1.24e-44 156 31 1 279 3 cyoE Protoheme IX farnesyltransferase Hahella chejuensis (strain KCTC 2396)
B8HMH3 1.25e-44 157 33 1 289 3 ctaB Protoheme IX farnesyltransferase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A6T2T7 1.31e-44 156 31 1 280 3 ctaB Protoheme IX farnesyltransferase Janthinobacterium sp. (strain Marseille)
Q39CQ5 1.64e-44 156 33 3 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7NIL7 2.03e-44 155 37 0 280 3 ctaB Protoheme IX farnesyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q476H8 2.73e-44 155 32 1 281 3 ctaB Protoheme IX farnesyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q63XS7 2.95e-44 155 32 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia pseudomallei (strain K96243)
A3N5D1 2.95e-44 155 32 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia pseudomallei (strain 668)
Q3JWF7 2.95e-44 155 32 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia pseudomallei (strain 1710b)
A3NR29 2.95e-44 155 32 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia pseudomallei (strain 1106a)
Q1BTD0 3.08e-44 155 33 3 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia orbicola (strain AU 1054)
B1JZ41 3.08e-44 155 33 3 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia orbicola (strain MC0-3)
B4EA84 3.08e-44 155 33 3 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0KAR0 3.08e-44 155 33 3 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia cenocepacia (strain HI2424)
B7K336 3.2e-44 155 34 1 290 3 ctaB Protoheme IX farnesyltransferase Rippkaea orientalis (strain PCC 8801 / RF-1)
A7N6I9 3.71e-44 155 38 2 231 3 cyoE2 Protoheme IX farnesyltransferase 2 Vibrio campbellii (strain ATCC BAA-1116)
Q9ZDI2 3.84e-44 155 32 2 283 3 ctaB Protoheme IX farnesyltransferase Rickettsia prowazekii (strain Madrid E)
B1KM58 4.01e-44 155 34 4 282 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella woodyi (strain ATCC 51908 / MS32)
A4JI25 4.62e-44 155 33 3 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q2T1F6 5.42e-44 154 32 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B8H7N5 6.38e-44 155 33 2 285 3 ctaB Protoheme IX farnesyltransferase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q67ML5 9.37e-44 154 34 1 232 3 ctaB Protoheme IX farnesyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q87IR2 1.01e-43 154 37 2 234 3 cyoE1 Protoheme IX farnesyltransferase 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7GNP0 1.6e-43 153 39 5 275 3 ctaB1 Protoheme IX farnesyltransferase 1 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A1UZV8 1.81e-43 153 32 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia mallei (strain SAVP1)
Q62F61 1.81e-43 153 32 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia mallei (strain ATCC 23344)
A2S646 1.81e-43 153 32 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia mallei (strain NCTC 10229)
A3MQ44 1.81e-43 153 32 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia mallei (strain NCTC 10247)
Q8Y2G4 3.19e-43 152 33 1 279 3 ctaB Protoheme IX farnesyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q0KER8 3.7e-43 152 34 1 281 3 ctaB Protoheme IX farnesyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
C4K2Q8 5.06e-43 152 34 0 223 3 ctaB Protoheme IX farnesyltransferase Rickettsia peacockii (strain Rustic)
A1SY55 5.51e-43 152 33 1 280 3 cyoE Protoheme IX farnesyltransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B0C0A5 5.97e-43 152 32 1 290 3 ctaB Protoheme IX farnesyltransferase Acaryochloris marina (strain MBIC 11017)
A2SKN7 6.26e-43 152 33 2 269 3 ctaB Protoheme IX farnesyltransferase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q3IJQ0 8.28e-43 152 31 1 281 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudoalteromonas translucida (strain TAC 125)
Q6LVR2 1.08e-42 151 32 2 279 3 cyoE Protoheme IX farnesyltransferase Photobacterium profundum (strain SS9)
A8GN36 1.11e-42 151 33 2 267 3 ctaB Protoheme IX farnesyltransferase Rickettsia akari (strain Hartford)
Q8NX68 1.43e-42 151 32 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain MW2)
Q6GA98 1.43e-42 151 32 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain MSSA476)
Q6GHW9 1.43e-42 151 32 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain MRSA252)
Q2YX83 1.43e-42 151 32 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q12E37 2.03e-42 150 32 2 281 3 ctaB Protoheme IX farnesyltransferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
B1XS75 2.09e-42 150 31 1 279 3 ctaB Protoheme IX farnesyltransferase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4T079 2.18e-42 150 31 1 279 3 ctaB Protoheme IX farnesyltransferase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B1XKB3 2.38e-42 150 35 1 291 3 ctaB Protoheme IX farnesyltransferase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q88RL9 2.56e-42 150 34 0 255 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q21XT4 2.95e-42 150 34 3 273 3 ctaB Protoheme IX farnesyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q2JNL3 3.04e-42 150 35 2 287 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q3KK91 3.16e-42 150 32 1 279 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas fluorescens (strain Pf0-1)
Q6AF34 3.31e-42 150 32 1 283 3 ctaB Protoheme IX farnesyltransferase Leifsonia xyli subsp. xyli (strain CTCB07)
A8Z1Q1 4.31e-42 149 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q7A664 4.31e-42 149 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain N315)
Q99UY7 4.31e-42 149 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QFX1 4.31e-42 149 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain Newman)
Q5HGW8 4.31e-42 149 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain COL)
A5IS03 4.31e-42 149 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain JH9)
Q2G2B9 4.31e-42 149 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHW4 4.31e-42 149 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain USA300)
A6U0T4 4.31e-42 149 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain JH1)
A7X128 4.31e-42 149 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B1Y6Q4 4.77e-42 149 32 4 287 3 ctaB Protoheme IX farnesyltransferase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q1IGZ4 5.32e-42 149 33 1 279 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas entomophila (strain L48)
Q4KKL2 8.52e-42 149 33 1 279 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q829U3 1.11e-41 149 31 1 286 3 ctaB Protoheme IX farnesyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q4L5D0 1.48e-41 148 33 5 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus haemolyticus (strain JCSC1435)
Q9I719 1.53e-41 148 33 2 283 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02UW5 1.53e-41 148 33 2 283 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q5P2E3 2.04e-41 148 34 3 283 3 ctaB Protoheme IX farnesyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A6UXP9 3.22e-41 147 32 2 283 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas aeruginosa (strain PA7)
Q146A1 3.29e-41 147 31 1 280 3 ctaB Protoheme IX farnesyltransferase Paraburkholderia xenovorans (strain LB400)
Q49WP1 3.5e-41 147 33 5 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q3MFT6 3.64e-41 147 34 1 282 3 ctaB Protoheme IX farnesyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A4XNK8 3.76e-41 147 34 0 234 3 cyoE Protoheme IX farnesyltransferase Pseudomonas mendocina (strain ymp)
A5VWP2 4.29e-41 147 34 0 255 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8YYA3 4.55e-41 147 35 1 282 3 ctaB Protoheme IX farnesyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A5UPV7 6.81e-41 151 33 2 282 3 ctaB Protoheme IX farnesyltransferase Roseiflexus sp. (strain RS-1)
A8GVN8 6.84e-41 146 30 1 266 3 ctaB Protoheme IX farnesyltransferase Rickettsia bellii (strain OSU 85-389)
A1VKM6 7.9e-41 146 33 2 270 3 ctaB Protoheme IX farnesyltransferase Polaromonas naphthalenivorans (strain CJ2)
Q2KTX0 8.49e-41 146 31 1 281 3 ctaB Protoheme IX farnesyltransferase Bordetella avium (strain 197N)
Q9XAC2 9.49e-41 146 31 1 286 3 ctaB Protoheme IX farnesyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A8F1B6 9.85e-41 146 32 3 268 3 ctaB Protoheme IX farnesyltransferase Rickettsia massiliae (strain Mtu5)
A7NRY4 1.01e-40 151 34 2 282 3 ctaB Protoheme IX farnesyltransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A8FPN0 1.12e-40 146 34 0 238 3 cyoE Protoheme IX farnesyltransferase Shewanella sediminis (strain HAW-EB3)
Q0ADH9 1.3e-40 145 31 1 280 3 ctaB Protoheme IX farnesyltransferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q0S0I5 1.37e-40 145 32 1 262 3 ctaB Protoheme IX farnesyltransferase Rhodococcus jostii (strain RHA1)
B9EB27 1.49e-40 145 31 6 274 3 ctaB Protoheme IX farnesyltransferase Macrococcus caseolyticus (strain JCSC5402)
A1WBL5 1.81e-40 145 31 3 285 3 ctaB Protoheme IX farnesyltransferase Acidovorax sp. (strain JS42)
B9MF14 1.81e-40 145 31 3 285 3 ctaB Protoheme IX farnesyltransferase Acidovorax ebreus (strain TPSY)
Q5N1X0 2.5e-40 145 36 1 278 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31JY9 2.5e-40 145 36 1 278 3 ctaB Protoheme IX farnesyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B0KFZ0 4.43e-40 144 33 0 255 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas putida (strain GB-1)
Q79EF2 4.66e-40 145 34 1 292 3 ctaB Protoheme IX farnesyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q83CV6 5.21e-40 144 36 0 230 3 cyoE Protoheme IX farnesyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NCT0 5.21e-40 144 36 0 230 3 cyoE Protoheme IX farnesyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KCC9 5.21e-40 144 36 0 230 3 cyoE Protoheme IX farnesyltransferase Coxiella burnetii (strain Dugway 5J108-111)
B6J085 5.21e-40 144 36 0 230 3 cyoE Protoheme IX farnesyltransferase Coxiella burnetii (strain CbuG_Q212)
B6J736 5.21e-40 144 36 0 230 3 cyoE Protoheme IX farnesyltransferase Coxiella burnetii (strain CbuK_Q154)
A1KAQ4 5.46e-40 144 34 3 266 3 ctaB Protoheme IX farnesyltransferase Azoarcus sp. (strain BH72)
A8GRQ1 5.85e-40 144 34 0 223 3 ctaB Protoheme IX farnesyltransferase Rickettsia rickettsii (strain Sheila Smith)
B0BX58 5.85e-40 144 34 0 223 3 ctaB Protoheme IX farnesyltransferase Rickettsia rickettsii (strain Iowa)
C1DG34 6.2e-40 144 37 0 209 3 cyoE Protoheme IX farnesyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1RI93 7.6e-40 144 30 1 266 3 ctaB Protoheme IX farnesyltransferase Rickettsia bellii (strain RML369-C)
Q92IF1 7.79e-40 144 34 0 223 3 ctaB Protoheme IX farnesyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PN58 7.79e-40 144 34 0 223 3 ctaB Protoheme IX farnesyltransferase Rickettsia africae (strain ESF-5)
Q8D6H2 1.15e-39 143 32 1 264 3 cyoE Protoheme IX farnesyltransferase Vibrio vulnificus (strain CMCP6)
A9GEU3 1.15e-39 142 34 1 228 3 ctaB Protoheme IX farnesyltransferase Sorangium cellulosum (strain So ce56)
Q4UM22 1.34e-39 143 34 0 223 3 ctaB Protoheme IX farnesyltransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A5CF31 1.55e-39 143 31 2 267 3 ctaB Protoheme IX farnesyltransferase Orientia tsutsugamushi (strain Boryong)
Q3J6R6 2.36e-39 142 30 1 279 3 cyoE Protoheme IX farnesyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0RH20 3.35e-39 142 33 1 281 3 ctaB Protoheme IX farnesyltransferase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q5HQ51 3.49e-39 142 30 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A1WHP5 3.57e-39 142 31 3 276 3 ctaB Protoheme IX farnesyltransferase Verminephrobacter eiseniae (strain EF01-2)
A5CRS6 3.95e-39 142 32 1 282 3 ctaB Protoheme IX farnesyltransferase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q8CPM1 4.95e-39 142 30 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
B9DPV9 5.16e-39 142 31 5 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus carnosus (strain TM300)
Q7MDC8 5.56e-39 141 32 1 264 3 cyoE Protoheme IX farnesyltransferase Vibrio vulnificus (strain YJ016)
A0QWY2 6.73e-39 141 33 1 248 3 ctaB Protoheme IX farnesyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B1J467 6.98e-39 141 32 1 279 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas putida (strain W619)
Q2YCM2 8.75e-39 141 30 3 281 3 ctaB Protoheme IX farnesyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1SBD7 8.96e-39 141 34 0 239 3 cyoE Protoheme IX farnesyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q2JQK9 9.19e-39 142 37 1 210 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain JA-3-3Ab)
Q7VT22 9.2e-39 140 31 3 284 3 ctaB Protoheme IX farnesyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B0REI2 9.6e-39 141 31 1 282 3 ctaB Protoheme IX farnesyltransferase Clavibacter sepedonicus
Q7W316 2.22e-38 140 31 3 284 3 ctaB Protoheme IX farnesyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WE16 2.22e-38 140 31 3 284 3 ctaB Protoheme IX farnesyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B4SHI1 2.71e-38 139 32 4 289 3 cyoE Protoheme IX farnesyltransferase Stenotrophomonas maltophilia (strain R551-3)
A0LTZ0 2.86e-38 140 32 2 285 3 ctaB Protoheme IX farnesyltransferase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q60CP3 3.46e-38 139 35 0 234 3 cyoE Protoheme IX farnesyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A6U6U6 3.52e-38 140 30 3 282 3 ctaB Protoheme IX farnesyltransferase Sinorhizobium medicae (strain WSM419)
Q82VQ6 4.28e-38 139 30 3 283 3 ctaB Protoheme IX farnesyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A9HWL4 4.75e-38 139 33 1 281 3 ctaB Protoheme IX farnesyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B3CTF6 5.06e-38 139 30 3 268 3 ctaB Protoheme IX farnesyltransferase Orientia tsutsugamushi (strain Ikeda)
B1W108 6.97e-38 139 31 2 286 3 ctaB Protoheme IX farnesyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q1D1K4 7.27e-38 138 31 2 276 3 ctaB Protoheme IX farnesyltransferase Myxococcus xanthus (strain DK1622)
C3MHJ3 9.61e-38 139 31 2 269 3 ctaB Protoheme IX farnesyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A7HQW1 1.11e-37 138 30 3 271 3 ctaB Protoheme IX farnesyltransferase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A1AV76 1.32e-37 138 36 1 227 3 cyoE Protoheme IX farnesyltransferase Ruthia magnifica subsp. Calyptogena magnifica
B1MC66 2.98e-37 137 33 1 265 3 ctaB Protoheme IX farnesyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q2GDE4 3.22e-37 137 29 2 287 3 ctaB Protoheme IX farnesyltransferase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q47G19 3.59e-37 137 31 3 283 3 ctaB Protoheme IX farnesyltransferase Dechloromonas aromatica (strain RCB)
A5CXZ0 3.73e-37 136 35 1 227 3 cyoE Protoheme IX farnesyltransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
B0SMP1 5.64e-37 135 31 2 282 3 ctaB Protoheme IX farnesyltransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SE58 5.64e-37 135 31 2 282 3 ctaB Protoheme IX farnesyltransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q5YTS1 8.01e-37 136 34 1 247 3 ctaB Protoheme IX farnesyltransferase Nocardia farcinica (strain IFM 10152)
Q1J1C3 1.02e-36 135 31 4 287 3 ctaB Protoheme IX farnesyltransferase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B7KHX2 1.42e-36 135 33 1 291 3 ctaB Protoheme IX farnesyltransferase Gloeothece citriformis (strain PCC 7424)
A1TU04 2.22e-36 135 29 3 282 3 ctaB Protoheme IX farnesyltransferase Paracidovorax citrulli (strain AAC00-1)
Q5GV87 2.53e-36 134 30 5 292 3 cyoE Protoheme IX farnesyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NYG1 2.53e-36 134 30 5 292 3 cyoE Protoheme IX farnesyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2JCG7 2.91e-36 134 33 0 242 3 ctaB Protoheme IX farnesyltransferase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q8P487 3.16e-36 134 31 5 292 3 cyoE Protoheme IX farnesyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RXJ1 3.16e-36 134 31 5 292 3 cyoE Protoheme IX farnesyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4UPT7 3.16e-36 134 31 5 292 3 cyoE Protoheme IX farnesyltransferase Xanthomonas campestris pv. campestris (strain 8004)
A8LW09 3.17e-36 134 35 1 227 3 ctaB Protoheme IX farnesyltransferase Salinispora arenicola (strain CNS-205)
B3PSB2 3.24e-36 134 29 2 269 3 ctaB Protoheme IX farnesyltransferase Rhizobium etli (strain CIAT 652)
A8KYS6 3.26e-36 134 32 3 269 3 ctaB Protoheme IX farnesyltransferase Parafrankia sp. (strain EAN1pec)
Q92RG8 3.45e-36 134 30 2 269 3 ctaB Protoheme IX farnesyltransferase Rhizobium meliloti (strain 1021)
Q2KBM1 3.6e-36 134 29 2 269 3 ctaB Protoheme IX farnesyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B5ZSV2 4.25e-36 134 29 2 286 3 ctaB Protoheme IX farnesyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B9JAP1 6.85e-36 134 30 2 269 3 ctaB Protoheme IX farnesyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q3BND5 8.97e-36 133 31 5 292 3 cyoE Protoheme IX farnesyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q1MKI5 1.06e-35 133 30 2 269 3 ctaB Protoheme IX farnesyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8PFU4 1.26e-35 132 31 5 292 3 cyoE Protoheme IX farnesyltransferase Xanthomonas axonopodis pv. citri (strain 306)
A4FBP2 1.29e-35 133 30 2 283 3 ctaB2 Protoheme IX farnesyltransferase 2 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q7P0G0 2.18e-35 132 32 1 275 3 ctaB1 Protoheme IX farnesyltransferase 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A6WC46 4.38e-35 132 34 0 228 3 ctaB Protoheme IX farnesyltransferase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
B3CN58 5.35e-35 131 30 4 276 3 ctaB Protoheme IX farnesyltransferase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A9HKH7 5.95e-35 131 29 4 276 3 ctaB Protoheme IX farnesyltransferase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q8F9F8 6.75e-35 130 31 5 282 3 ctaB Protoheme IX farnesyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72VU2 6.75e-35 130 31 5 282 3 ctaB Protoheme IX farnesyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A5FJD0 7.17e-35 130 32 7 287 3 ctaB Protoheme IX farnesyltransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
B0JGA8 1.08e-34 130 34 1 290 3 ctaB Protoheme IX farnesyltransferase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q055W1 1.37e-34 129 30 2 276 3 ctaB Protoheme IX farnesyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PG4 1.37e-34 129 30 2 276 3 ctaB Protoheme IX farnesyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B0T0X6 1.53e-34 131 32 3 235 3 ctaB Protoheme IX farnesyltransferase Caulobacter sp. (strain K31)
A4X9F8 3.12e-34 129 35 1 227 3 ctaB Protoheme IX farnesyltransferase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q1B9B1 3.28e-34 129 31 2 288 3 ctaB Protoheme IX farnesyltransferase Mycobacterium sp. (strain MCS)
A1UFQ0 3.28e-34 129 31 2 288 3 ctaB Protoheme IX farnesyltransferase Mycobacterium sp. (strain KMS)
A3PZB2 3.28e-34 129 31 2 288 3 ctaB Protoheme IX farnesyltransferase Mycobacterium sp. (strain JLS)
Q9RR78 3.93e-34 129 31 1 238 3 ctaB Protoheme IX farnesyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q6G4C6 4.27e-34 129 29 5 271 3 ctaB Protoheme IX farnesyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A6WWG0 8.63e-34 128 28 5 294 3 ctaB Protoheme IX farnesyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q9PDL9 9.04e-34 128 31 5 292 3 cyoE Protoheme IX farnesyltransferase Xylella fastidiosa (strain 9a5c)
A0PPP7 1.11e-33 128 33 3 248 3 ctaB Protoheme IX farnesyltransferase Mycobacterium ulcerans (strain Agy99)
Q87DT0 1.26e-33 127 31 4 290 3 cyoE Protoheme IX farnesyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P9WFR7 1.52e-33 127 31 1 262 3 ctaB Protoheme IX farnesyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFR6 1.52e-33 127 31 1 262 3 ctaB Protoheme IX farnesyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1QRH1 1.52e-33 127 31 1 262 3 ctaB1 Protoheme IX farnesyltransferase Mycobacterium tuberculosis (strain F11)
A5U2F4 1.52e-33 127 31 1 262 3 ctaB Protoheme IX farnesyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q0BPU7 1.95e-33 127 28 3 280 3 ctaB Protoheme IX farnesyltransferase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q2IPE5 2.34e-33 126 31 6 285 3 ctaB Protoheme IX farnesyltransferase Anaeromyxobacter dehalogenans (strain 2CP-C)
A4TC38 2.85e-33 127 30 2 288 3 ctaB Protoheme IX farnesyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
Q01YC2 3.33e-33 126 31 6 292 3 ctaB Protoheme IX farnesyltransferase Solibacter usitatus (strain Ellin6076)
A9IQQ6 3.59e-33 126 29 3 271 3 ctaB Protoheme IX farnesyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
P67054 4.33e-33 126 28 2 270 3 ctaB Protoheme IX farnesyltransferase Brucella suis biovar 1 (strain 1330)
A5VP40 4.33e-33 126 28 2 270 3 ctaB Protoheme IX farnesyltransferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P67053 4.33e-33 126 28 2 270 3 ctaB Protoheme IX farnesyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q83GF8 4.69e-33 126 30 0 241 3 ctaB Protoheme IX farnesyltransferase Tropheryma whipplei (strain Twist)
Q83NK0 4.69e-33 126 30 0 241 3 ctaB Protoheme IX farnesyltransferase Tropheryma whipplei (strain TW08/27)
C0RHH6 4.91e-33 126 28 2 270 3 ctaB Protoheme IX farnesyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8Z3 4.91e-33 126 28 2 270 3 ctaB Protoheme IX farnesyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9CCN4 4.96e-33 126 31 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacterium leprae (strain TN)
C1AN96 5.62e-33 126 31 1 262 3 ctaB Protoheme IX farnesyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KIP0 5.62e-33 126 31 1 262 3 ctaB Protoheme IX farnesyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U021 5.62e-33 126 31 1 262 3 ctaB Protoheme IX farnesyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q3SLW5 6.48e-33 125 31 1 279 3 ctaB Protoheme IX farnesyltransferase Thiobacillus denitrificans (strain ATCC 25259)
B0CKF4 7.54e-33 125 29 4 275 3 ctaB Protoheme IX farnesyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8NQ66 7.91e-33 126 30 5 300 3 ctaB Protoheme IX farnesyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QEE9 7.91e-33 126 30 5 300 3 ctaB Protoheme IX farnesyltransferase Corynebacterium glutamicum (strain R)
Q741B3 1.12e-32 125 30 1 247 3 ctaB Protoheme IX farnesyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8FT77 1.21e-32 125 30 3 298 3 ctaB Protoheme IX farnesyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A1SJR1 1.87e-32 124 29 1 287 3 ctaB Protoheme IX farnesyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
A1T8M8 2.73e-32 124 31 1 247 3 ctaB Protoheme IX farnesyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q0AMG9 4.34e-32 124 31 1 230 3 ctaB Protoheme IX farnesyltransferase Maricaulis maris (strain MCS10)
B7KVJ7 6.34e-32 123 33 2 222 3 ctaB Protoheme IX farnesyltransferase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B1ZKN8 1.02e-31 123 32 2 222 3 ctaB Protoheme IX farnesyltransferase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q1GTA5 1.13e-31 122 30 1 230 3 ctaB Protoheme IX farnesyltransferase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
C0R2X3 1.24e-31 122 27 4 276 3 ctaB Protoheme IX farnesyltransferase Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q6NH44 1.67e-31 122 30 4 302 3 ctaB Protoheme IX farnesyltransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q3YR13 1.89e-31 121 29 1 254 3 ctaB Protoheme IX farnesyltransferase Ehrlichia canis (strain Jake)
A0QHX0 2.07e-31 122 30 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacterium avium (strain 104)
Q13CY5 2.55e-31 122 28 2 276 3 ctaB Protoheme IX farnesyltransferase Rhodopseudomonas palustris (strain BisB5)
Q5HAA6 3.15e-31 121 29 2 268 3 ctaB Protoheme IX farnesyltransferase Ehrlichia ruminantium (strain Welgevonden)
A8IDL3 3.46e-31 121 30 2 269 3 ctaB Protoheme IX farnesyltransferase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A6H1E4 3.46e-31 121 31 7 287 3 ctaB Protoheme IX farnesyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q73I75 3.5e-31 120 28 4 276 3 ctaB Protoheme IX farnesyltransferase Wolbachia pipientis wMel
Q5FPU4 4.06e-31 121 29 2 256 3 ctaB Protoheme IX farnesyltransferase Gluconobacter oxydans (strain 621H)
A4Z2D2 5.99e-31 120 28 3 284 3 ctaB Protoheme IX farnesyltransferase Bradyrhizobium sp. (strain ORS 278)
Q5FGC3 6.28e-31 120 29 2 268 3 ctaB Protoheme IX farnesyltransferase Ehrlichia ruminantium (strain Gardel)
Q6G0D0 7.01e-31 120 28 3 270 3 ctaB Protoheme IX farnesyltransferase Bartonella quintana (strain Toulouse)
Q72H22 1.56e-30 124 36 0 211 3 ctaB Protoheme IX farnesyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B8I9Q3 1.58e-30 119 34 3 223 3 ctaB Protoheme IX farnesyltransferase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q5SLI3 1.63e-30 123 36 0 211 3 ctaB Protoheme IX farnesyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A5EA98 1.64e-30 119 28 3 283 3 ctaB Protoheme IX farnesyltransferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q985X0 1.98e-30 119 33 4 226 3 ctaB2 Protoheme IX farnesyltransferase 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5GSX9 2.18e-30 119 28 1 208 3 ctaB Protoheme IX farnesyltransferase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q28MJ1 2.5e-30 119 31 1 233 3 ctaB Protoheme IX farnesyltransferase Jannaschia sp. (strain CCS1)
Q9A301 2.51e-30 119 31 1 234 3 ctaB Protoheme IX farnesyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A5VD56 2.57e-30 119 31 2 232 3 ctaB Protoheme IX farnesyltransferase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B0UFS2 2.84e-30 119 34 1 186 3 ctaB Protoheme IX farnesyltransferase Methylobacterium sp. (strain 4-46)
Q2GFJ2 3.3e-30 118 30 1 217 3 ctaB Protoheme IX farnesyltransferase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q07HB2 4.95e-30 118 29 2 271 3 ctaB Protoheme IX farnesyltransferase Rhodopseudomonas palustris (strain BisA53)
B2IGJ6 6.33e-30 118 30 3 271 3 ctaB Protoheme IX farnesyltransferase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q6MR11 1.6e-29 116 30 3 239 3 ctaB Protoheme IX farnesyltransferase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q11KD2 1.62e-29 117 31 0 192 3 ctaB Protoheme IX farnesyltransferase Chelativorans sp. (strain BNC1)
Q2IR91 1.76e-29 117 28 2 276 3 ctaB Protoheme IX farnesyltransferase Rhodopseudomonas palustris (strain HaA2)
A7H8V9 2.27e-29 116 29 3 276 3 ctaB Protoheme IX farnesyltransferase Anaeromyxobacter sp. (strain Fw109-5)
Q47ND5 2.32e-29 117 31 1 286 3 ctaB Protoheme IX farnesyltransferase Thermobifida fusca (strain YX)
Q20X25 3.11e-29 116 29 2 271 3 ctaB Protoheme IX farnesyltransferase Rhodopseudomonas palustris (strain BisB18)
A1URX1 3.42e-29 116 31 2 216 3 ctaB Protoheme IX farnesyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q2NCF2 3.44e-29 115 28 5 289 3 ctaB Protoheme IX farnesyltransferase Erythrobacter litoralis (strain HTCC2594)
Q6NBJ5 3.64e-29 116 27 2 283 3 ctaB Protoheme IX farnesyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B6JDB7 4.37e-29 115 29 2 232 3 ctaB Protoheme IX farnesyltransferase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q0C3D1 7.43e-29 115 31 3 229 3 ctaB Protoheme IX farnesyltransferase Hyphomonas neptunium (strain ATCC 15444)
Q11SZ7 7.55e-29 114 32 2 219 3 ctaB Protoheme IX farnesyltransferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A9CJX3 8.96e-29 115 30 1 238 3 ctaB Protoheme IX farnesyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q98LF1 1.26e-28 114 31 2 216 3 ctaB1 Protoheme IX farnesyltransferase 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B8EPK3 1.93e-28 114 30 1 229 3 ctaB Protoheme IX farnesyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q4JVK2 2.45e-28 114 31 6 301 3 ctaB Protoheme IX farnesyltransferase Corynebacterium jeikeium (strain K411)
Q6A7G0 3.15e-28 114 34 2 233 3 ctaB Protoheme IX farnesyltransferase Cutibacterium acnes (strain DSM 16379 / KPA171202)
B9KLZ5 3.68e-28 113 32 1 193 3 ctaB Protoheme IX farnesyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A9WAQ6 6.29e-28 116 30 0 234 3 ctaB Protoheme IX farnesyltransferase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B1ZMT0 6.65e-28 112 32 8 270 3 ctaB Protoheme IX farnesyltransferase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q3J5F9 7.27e-28 112 32 1 193 1 ctaB Protoheme IX farnesyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGX5 7.27e-28 112 32 1 193 3 ctaB Protoheme IX farnesyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q9RM98 7.99e-28 112 27 2 276 3 ctaB Protoheme IX farnesyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A5G0I2 8.71e-28 112 31 1 229 3 ctaB Protoheme IX farnesyltransferase Acidiphilium cryptum (strain JF-5)
Q1QHV7 9.09e-28 112 26 2 271 3 ctaB1 Protoheme IX farnesyltransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q5P9Y8 1.33e-27 111 33 3 220 3 ctaB Protoheme IX farnesyltransferase Anaplasma marginale (strain St. Maries)
B9KGP6 1.33e-27 111 33 3 220 3 ctaB Protoheme IX farnesyltransferase Anaplasma marginale (strain Florida)
A4WQ57 1.41e-27 111 31 1 213 3 ctaB Protoheme IX farnesyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q8CFY5 1.5e-27 114 30 5 246 2 Cox10 Protoheme IX farnesyltransferase, mitochondrial Mus musculus
Q2S012 2.43e-27 110 30 6 285 3 ctaB Protoheme IX farnesyltransferase Salinibacter ruber (strain DSM 13855 / M31)
B1M595 2.45e-27 111 31 3 236 3 ctaB Protoheme IX farnesyltransferase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
P56938 2.75e-27 110 30 1 213 3 ctaB Protoheme IX farnesyltransferase Cereibacter sphaeroides
Q18JU9 2.76e-27 113 29 2 219 3 ctaB Protoheme IX farnesyltransferase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q3IRC9 4.14e-27 112 29 3 243 3 ctaB1 Protoheme IX farnesyltransferase 1 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q3SUL3 4.36e-27 110 27 2 271 3 ctaB2 Protoheme IX farnesyltransferase 2 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q3SW48 4.36e-27 110 27 2 271 3 ctaB1 Protoheme IX farnesyltransferase 1 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A4F9B0 4.84e-27 110 32 0 222 3 ctaB1 Protoheme IX farnesyltransferase 1 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q12887 6.07e-27 112 35 2 168 1 COX10 Protoheme IX farnesyltransferase, mitochondrial Homo sapiens
Q1GE49 6.37e-27 110 34 3 202 3 ctaB Protoheme IX farnesyltransferase Ruegeria sp. (strain TM1040)
A0LXT1 9.23e-27 109 29 6 286 3 ctaB Protoheme IX farnesyltransferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q167W1 1.03e-26 109 32 0 173 3 ctaB Protoheme IX farnesyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q39Z26 1.89e-26 107 31 4 214 3 ctaB Protoheme IX farnesyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q2G9W3 2.22e-26 108 28 1 230 3 ctaB Protoheme IX farnesyltransferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q5R460 2.85e-26 110 36 2 161 2 COX10 Protoheme IX farnesyltransferase, mitochondrial Pongo abelii
Q5LNX8 3.16e-26 108 32 4 229 3 ctaB Protoheme IX farnesyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A1RRA6 6.13e-26 106 31 2 223 3 ctaB Protoheme IX farnesyltransferase Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
Q4FPD2 7.99e-26 107 26 1 243 3 ctaB Protoheme IX farnesyltransferase Pelagibacter ubique (strain HTCC1062)
Q74GM3 1.27e-25 105 30 5 230 3 ctaB Protoheme IX farnesyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B1I6G5 1.36e-25 106 30 3 281 3 ctaB Protoheme IX farnesyltransferase Desulforudis audaxviator (strain MP104C)
O28243 5.92e-25 103 28 5 263 3 ctaB Protoheme IX farnesyltransferase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A3MXH2 1.01e-24 103 33 1 199 3 ctaB1 Protoheme IX farnesyltransferase 1 Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q2W9D1 1.99e-24 102 32 2 204 3 ctaB1 Protoheme IX farnesyltransferase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q5V5S6 2.39e-24 105 29 2 205 3 ctaB Protoheme IX farnesyltransferase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
A1BA40 2.68e-24 102 30 0 198 3 ctaB Protoheme IX farnesyltransferase Paracoccus denitrificans (strain Pd 1222)
Q1IPI1 3.65e-24 102 29 8 295 3 ctaB Protoheme IX farnesyltransferase Koribacter versatilis (strain Ellin345)
A8LHT6 7.29e-24 102 32 0 198 3 ctaB Protoheme IX farnesyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B1YB28 7.96e-24 100 31 2 205 3 ctaB Protoheme IX farnesyltransferase Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)
A4YI90 3.96e-23 99 32 5 237 3 ctaB Protoheme IX farnesyltransferase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q2GJ17 4.02e-23 99 29 3 219 3 ctaB Protoheme IX farnesyltransferase Anaplasma phagocytophilum (strain HZ)
Q9Y7Y4 5.47e-23 100 28 8 271 3 cox10 Protoheme IX farnesyltransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P08301 1.48e-22 98 29 0 198 3 ctaB Protoheme IX farnesyltransferase Paracoccus denitrificans
A3MXJ5 1.51e-22 97 28 3 264 3 ctaB2 Protoheme IX farnesyltransferase 2 Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q9UX46 1.52e-22 97 30 1 207 3 ctaB Protoheme IX farnesyltransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A5GRR8 2.26e-22 98 30 2 270 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain RCC307)
B1L5A4 2.36e-22 97 29 2 209 3 ctaB Protoheme IX farnesyltransferase Korarchaeum cryptofilum (strain OPF8)
Q3ALZ8 2.74e-22 97 31 0 210 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain CC9605)
A4WIG5 3.17e-22 96 30 1 203 3 ctaB Protoheme IX farnesyltransferase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
Q3AV04 3.18e-22 97 30 0 210 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain CC9902)
Q7U550 4.09e-22 97 31 0 210 3 ctaB Protoheme IX farnesyltransferase Parasynechococcus marenigrum (strain WH8102)
C3NEK7 4.63e-22 96 29 4 271 3 ctaB Protoheme IX farnesyltransferase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
Q9HRJ8 5.3e-22 98 29 2 227 3 ctaB Protoheme IX farnesyltransferase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R3W4 5.9e-22 98 29 2 227 3 ctaB Protoheme IX farnesyltransferase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
C3NH36 6.62e-22 95 30 5 270 3 ctaB Protoheme IX farnesyltransferase Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
C3MW09 6.62e-22 95 30 5 270 3 ctaB Protoheme IX farnesyltransferase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MQD0 6.62e-22 95 30 5 270 3 ctaB Protoheme IX farnesyltransferase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C4KHL5 6.62e-22 95 30 5 270 3 ctaB Protoheme IX farnesyltransferase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3N652 6.62e-22 95 30 5 270 3 ctaB Protoheme IX farnesyltransferase Sulfolobus islandicus (strain M.16.27)
A0RUY7 7.31e-22 96 33 5 214 3 ctaB1 Protoheme IX farnesyltransferase 1 Cenarchaeum symbiosum (strain A)
A0RZ28 9.75e-22 95 32 12 299 3 ctaB2 Protoheme IX farnesyltransferase 2 Cenarchaeum symbiosum (strain A)
Q6CTW6 1.48e-21 97 27 5 255 3 COX10 Protoheme IX farnesyltransferase, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
A5GMY0 1.52e-21 95 30 1 225 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain WH7803)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00500
Feature type CDS
Gene cyoE
Product heme o synthase
Location 130455 - 131339 (strand: -1)
Length 885 (nucleotides) / 294 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2101
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01040 UbiA prenyltransferase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0109 Coenzyme transport and metabolism (H)
Lipid transport and metabolism (I)		 HI Polyprenyltransferase (heme O synthase)

Kegg Ortholog Annotation(s)

Protein Sequence

MIKQYLQVTKPGIIFGNLISVIGGFLLASKGEIDYPLFFATLLGVSLVVASGCVFNNYIDRDIDRIMERTKNRPLVQGLIDPQISLIYASVLGIAGVVLLYVAANPLAMFIAVFGFIIYVGVYSLYMKRKSVYGTLIGSLSGSAPPVIGYCAVSGEFDAGAAILLLIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVIKGISVAKRHIILYILAFMVATLMLTLVGYAGYKYLIVASAVSIWWLGMALSGYKATNDKVWARKLFIFSIIAITSLSVMMSVDPTSSTETVLAYLR

Flanking regions ( +/- flanking 50bp)

ATTATGTACAACCTGAACATCAATATGATGATGGATTAAGAGTTGTCGCTATGATTAAGCAATACCTACAAGTCACCAAACCAGGAATTATTTTCGGAAATTTAATTTCTGTGATAGGTGGTTTCCTTCTCGCCTCAAAAGGCGAGATTGACTACCCCCTATTTTTCGCGACTCTACTTGGGGTGTCTCTGGTCGTTGCTTCTGGTTGTGTTTTTAACAACTATATTGACCGTGATATTGACCGTATCATGGAAAGAACGAAGAATCGTCCATTAGTTCAAGGATTAATCGACCCGCAAATTAGCCTTATTTATGCCTCAGTATTAGGTATTGCAGGTGTTGTGCTGCTCTATGTAGCAGCCAACCCACTTGCAATGTTTATCGCTGTATTCGGCTTTATTATTTATGTTGGGGTTTATAGCCTCTATATGAAACGTAAATCTGTTTATGGCACACTGATCGGTAGTTTATCAGGCTCTGCACCACCAGTAATCGGCTACTGTGCTGTTAGCGGTGAATTTGATGCGGGTGCAGCAATTTTATTACTTATCTTTAGTTTGTGGCAAATGCCTCACTCTTATGCCATTGCGATTTTCCGTTTTAAAGACTACCAAGCAGCCAATATCCCCGTATTACCTGTTATTAAAGGGATCTCAGTCGCTAAGCGCCATATTATTCTCTATATTCTGGCCTTTATGGTTGCAACGCTGATGCTAACTTTAGTGGGATATGCAGGGTATAAATACCTGATTGTTGCCTCTGCAGTCAGTATCTGGTGGTTGGGCATGGCATTATCTGGTTATAAAGCAACCAATGATAAAGTGTGGGCAAGAAAATTATTTATATTTTCTATCATTGCCATTACATCATTAAGTGTAATGATGTCTGTTGATCCCACCAGTTCAACAGAAACGGTTCTCGCTTATCTGAGATAATGTAATTTCAATTGCAAAAAATGCTAATGCCAGTCAATCATGACTGGCAT