Homologs in group_2139

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15820 FBDBKF_15820 100.0 Morganella morganii S1 cyoE heme o synthase
NLDBIP_17255 NLDBIP_17255 100.0 Morganella morganii S4 cyoE heme o synthase
LHKJJB_17405 LHKJJB_17405 100.0 Morganella morganii S3 cyoE heme o synthase
HKOGLL_16990 HKOGLL_16990 100.0 Morganella morganii S5 cyoE heme o synthase
F4V73_RS16490 F4V73_RS16490 95.9 Morganella psychrotolerans cyoE heme o synthase
PMI_RS00500 PMI_RS00500 85.7 Proteus mirabilis HI4320 cyoE heme o synthase

Distribution of the homologs in the orthogroup group_2139

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2139

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N0K3 0.0 514 88 0 294 3 cyoE Protoheme IX farnesyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JNP6 0.0 504 86 2 295 3 cyoE Protoheme IX farnesyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JHT2 0.0 503 87 1 294 3 cyoE Protoheme IX farnesyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FLD4 0.0 503 87 1 294 3 cyoE Protoheme IX farnesyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66DU5 0.0 503 87 1 294 3 cyoE Protoheme IX farnesyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPF3 0.0 503 87 1 294 3 cyoE Protoheme IX farnesyltransferase Yersinia pestis (strain Pestoides F)
Q1CL75 0.0 503 87 1 294 3 cyoE Protoheme IX farnesyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
Q0WCB5 0.0 503 87 1 294 3 cyoE Protoheme IX farnesyltransferase Yersinia pestis
Q1C4J8 0.0 503 87 1 294 3 cyoE Protoheme IX farnesyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A8GAQ0 1.12e-174 487 82 1 294 3 cyoE Protoheme IX farnesyltransferase Serratia proteamaculans (strain 568)
B2VHR9 8.09e-174 485 85 0 281 3 cyoE Protoheme IX farnesyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MFG8 3.29e-173 483 85 0 281 3 cyoE Protoheme IX farnesyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
Q6D836 1.07e-172 482 82 2 296 3 cyoE Protoheme IX farnesyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DB46 2.2e-172 481 82 2 296 3 cyoE Protoheme IX farnesyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BFX0 6.95e-172 480 83 0 285 3 cyoE Protoheme IX farnesyltransferase Edwardsiella ictaluri (strain 93-146)
Q2NV87 4.06e-170 475 82 2 294 3 cyoE Protoheme IX farnesyltransferase Sodalis glossinidius (strain morsitans)
A6T5H1 2.93e-169 473 81 1 295 3 cyoE Protoheme IX farnesyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q325H3 3.91e-168 470 82 0 281 3 cyoE Protoheme IX farnesyltransferase Shigella boydii serotype 4 (strain Sb227)
B1LJI2 3.91e-168 470 82 0 281 3 cyoE Protoheme IX farnesyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
P0AEA5 3.91e-168 470 82 0 281 1 cyoE Protoheme IX farnesyltransferase Escherichia coli (strain K12)
B1J021 3.91e-168 470 82 0 281 3 cyoE Protoheme IX farnesyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AEA6 3.91e-168 470 82 0 281 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A7ZX84 3.91e-168 470 82 0 281 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O9:H4 (strain HS)
B1XFL6 3.91e-168 470 82 0 281 3 cyoE Protoheme IX farnesyltransferase Escherichia coli (strain K12 / DH10B)
P0AEA7 3.91e-168 470 82 0 281 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O157:H7
A7ZII5 3.91e-168 470 82 0 281 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AK26 6.91e-168 470 82 0 281 3 cyoE Protoheme IX farnesyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q1RFB2 1.36e-167 469 82 0 281 3 cyoE Protoheme IX farnesyltransferase Escherichia coli (strain UTI89 / UPEC)
Q0TKL4 1.36e-167 469 82 0 281 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A897 1.36e-167 469 82 0 281 3 cyoE Protoheme IX farnesyltransferase Escherichia coli O1:K1 / APEC
Q3Z4X5 1.52e-167 469 82 0 281 3 cyoE Protoheme IX farnesyltransferase Shigella sonnei (strain Ss046)
A4W799 4.44e-167 468 82 0 281 3 cyoE Protoheme IX farnesyltransferase Enterobacter sp. (strain 638)
Q83SF7 4.55e-167 468 82 0 281 3 cyoE Protoheme IX farnesyltransferase Shigella flexneri
Q8Z8V5 7.45e-167 467 82 0 281 3 cyoE Protoheme IX farnesyltransferase Salmonella typhi
A9MWZ0 1.23e-166 466 82 0 281 3 cyoE Protoheme IX farnesyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q8ZRC4 1.29e-166 466 82 0 281 3 cyoE Protoheme IX farnesyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PFP5 1.29e-166 466 82 0 281 3 cyoE Protoheme IX farnesyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57SC4 1.29e-166 466 82 0 281 3 cyoE Protoheme IX farnesyltransferase Salmonella choleraesuis (strain SC-B67)
A9MM32 4.39e-165 462 81 0 281 3 cyoE Protoheme IX farnesyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4SPY8 1.17e-157 444 82 1 281 3 cyoE Protoheme IX farnesyltransferase Aeromonas salmonicida (strain A449)
A0KME5 7.71e-157 442 79 2 293 3 cyoE Protoheme IX farnesyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q48M92 1.82e-141 403 66 0 292 3 cyoE Protoheme IX farnesyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1H1S8 3.64e-141 402 68 0 280 3 ctaB Protoheme IX farnesyltransferase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q887G7 1.06e-140 401 66 0 292 3 cyoE Protoheme IX farnesyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3K773 1.5e-140 400 67 0 292 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas fluorescens (strain Pf0-1)
Q4K6M1 1.61e-140 400 67 0 293 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4ZXC3 2.75e-140 400 66 0 292 3 cyoE Protoheme IX farnesyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q1QYZ3 2.88e-138 395 65 0 285 3 cyoE Protoheme IX farnesyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1IEP0 4.76e-136 389 64 0 292 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas entomophila (strain L48)
Q88PN3 2.57e-135 387 63 0 292 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VYP1 2.57e-135 387 63 0 292 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1JDU9 3.53e-135 387 63 0 292 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas putida (strain W619)
Q9WWR5 3.65e-135 387 63 0 292 3 cyoE Protoheme IX farnesyltransferase Pseudomonas putida
B0KPE4 7.19e-135 386 63 0 292 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas putida (strain GB-1)
Q7NQZ3 7.26e-134 384 68 1 280 3 ctaB2 Protoheme IX farnesyltransferase 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9I423 7.86e-129 371 65 0 284 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02JG2 7.86e-129 371 65 0 284 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V8N8 8.49e-129 371 65 0 284 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudomonas aeruginosa (strain PA7)
Q1LTJ4 1.46e-121 352 60 2 283 3 cyoE Protoheme IX farnesyltransferase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q089I2 6.49e-120 348 61 1 281 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella frigidimarina (strain NCIMB 400)
A0L2I3 2.09e-119 347 61 1 280 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella sp. (strain ANA-3)
Q0HPR0 5.34e-119 347 61 1 280 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella sp. (strain MR-7)
A6WU49 6.36e-119 346 61 1 283 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella baltica (strain OS185)
Q0HDH7 6.5e-119 346 61 1 280 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella sp. (strain MR-4)
A1RE49 1.39e-118 345 60 1 283 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella sp. (strain W3-18-1)
A4YC85 6.01e-118 344 60 1 283 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q3IHM5 1.15e-117 342 60 1 292 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudoalteromonas translucida (strain TAC 125)
A6VRF6 1.71e-117 342 60 1 282 3 cyoE Protoheme IX farnesyltransferase Marinomonas sp. (strain MWYL1)
A9KV13 3.94e-116 338 61 1 278 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella baltica (strain OS195)
B1KQ72 5.06e-116 338 61 1 273 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella woodyi (strain ATCC 51908 / MS32)
Q15WB8 1.29e-115 337 60 1 280 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A3Q9U4 2.18e-113 332 59 1 284 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q493G3 9.64e-102 302 53 2 266 3 cyoE Protoheme IX farnesyltransferase Blochmanniella pennsylvanica (strain BPEN)
Q6MBY2 2e-96 288 49 1 281 3 ctaB Protoheme IX farnesyltransferase Protochlamydia amoebophila (strain UWE25)
Q6F9R1 3.45e-92 278 49 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q7VRH6 1.11e-91 276 45 3 286 3 cyoE Protoheme IX farnesyltransferase Blochmanniella floridana
Q8D350 3.7e-90 272 50 2 284 3 cyoE Protoheme IX farnesyltransferase Wigglesworthia glossinidia brevipalpis
B0V7G8 1.81e-87 266 50 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baumannii (strain AYE)
A3M6Q3 1.81e-87 266 50 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VM11 1.81e-87 266 50 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baumannii (strain SDF)
B7IBC0 1.81e-87 266 50 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baumannii (strain AB0057)
B7H0K1 1.81e-87 266 50 0 279 3 cyoE Protoheme IX farnesyltransferase Acinetobacter baumannii (strain AB307-0294)
B6EQE1 4.93e-87 265 46 1 282 3 cyoE Protoheme IX farnesyltransferase Aliivibrio salmonicida (strain LFI1238)
Q87IH5 7.34e-86 261 47 1 282 3 cyoE2 Protoheme IX farnesyltransferase 2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N2M2 8.32e-80 246 47 1 282 3 cyoE1 Protoheme IX farnesyltransferase 1 Vibrio campbellii (strain ATCC BAA-1116)
A7N9N4 4.15e-77 239 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
A4IZX0 7.15e-77 238 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BNW5 7.15e-77 238 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4E4 7.15e-77 238 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. novicida (strain U112)
Q2A5L1 1.05e-76 238 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. holarctica (strain LVS)
B8D7Z7 1.94e-76 237 43 1 282 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57540 1.94e-76 237 43 1 282 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9P5 1.94e-76 237 43 1 282 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q5NI07 8.98e-75 233 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JF9 8.98e-75 233 43 2 279 3 cyoE Protoheme IX farnesyltransferase Francisella tularensis subsp. tularensis (strain FSC 198)
Q8K997 1.3e-70 223 43 0 281 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
O31652 1.43e-63 206 38 4 288 1 ctaB1 Protoheme IX farnesyltransferase 1 Bacillus subtilis (strain 168)
Q89AA7 3.84e-63 203 41 0 273 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9K9M9 3.22e-62 202 40 4 283 3 ctaB Protoheme IX farnesyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q04444 3.54e-60 197 39 3 283 3 ctaB Protoheme IX farnesyltransferase Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q65K13 1.82e-58 192 39 4 285 3 ctaB Protoheme IX farnesyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B8DH72 2.23e-57 189 39 4 285 3 ctaB Protoheme IX farnesyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q71XV7 2.23e-57 189 39 4 285 3 ctaB Protoheme IX farnesyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KX10 2.23e-57 189 39 4 285 3 ctaB Protoheme IX farnesyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8Y5K3 2.48e-57 189 39 4 285 3 ctaB Protoheme IX farnesyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q929W0 2.76e-57 189 39 5 291 3 ctaB Protoheme IX farnesyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AKG3 1.18e-56 187 39 4 285 3 ctaB Protoheme IX farnesyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P24009 2.72e-56 186 38 4 285 1 ctaB2 Protoheme IX farnesyltransferase 2 Bacillus subtilis (strain 168)
A7Z4B1 5.24e-56 186 38 4 285 3 ctaB2 Protoheme IX farnesyltransferase 2 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A7Z2K2 1.7e-55 185 35 2 286 3 ctaB1 Protoheme IX farnesyltransferase 1 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
O66544 7.74e-55 182 36 1 280 3 ctaB Protoheme IX farnesyltransferase Aquifex aeolicus (strain VF5)
B1HPV1 1.35e-54 182 38 4 281 3 ctaB1 Protoheme IX farnesyltransferase 1 Lysinibacillus sphaericus (strain C3-41)
B1YIW5 2.2e-54 182 39 4 283 3 ctaB Protoheme IX farnesyltransferase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
C5D862 2.75e-54 181 36 5 284 3 ctaB Protoheme IX farnesyltransferase Geobacillus sp. (strain WCH70)
Q8CXI8 3.11e-54 181 37 3 264 3 ctaB Protoheme IX farnesyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5X7X6 6.39e-54 180 38 1 266 3 cyoE Protoheme IX farnesyltransferase Legionella pneumophila (strain Paris)
Q5ZYG0 5.91e-53 177 37 1 266 3 cyoE Protoheme IX farnesyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHI2 5.91e-53 177 37 1 266 3 cyoE Protoheme IX farnesyltransferase Legionella pneumophila (strain Corby)
Q5WZC7 1.59e-52 176 37 1 266 3 cyoE Protoheme IX farnesyltransferase Legionella pneumophila (strain Lens)
A4ILX0 1.31e-51 174 39 5 285 3 ctaB Protoheme IX farnesyltransferase Geobacillus thermodenitrificans (strain NG80-2)
A9VUA6 1.78e-51 174 36 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus mycoides (strain KBAB4)
Q5L114 2.47e-51 174 40 6 285 3 ctaB Protoheme IX farnesyltransferase Geobacillus kaustophilus (strain HTA426)
A4VS42 3.56e-51 173 34 1 279 3 cyoE Protoheme IX farnesyltransferase Stutzerimonas stutzeri (strain A1501)
A8FCU6 4.1e-51 173 35 4 283 3 ctaB Protoheme IX farnesyltransferase Bacillus pumilus (strain SAFR-032)
Q057F2 1.21e-50 171 36 2 255 3 cyoE Protoheme IX farnesyltransferase Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q21PS1 3.18e-49 168 34 1 279 3 cyoE Protoheme IX farnesyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q15N01 3.46e-49 168 35 1 267 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q0VN94 6.65e-49 167 33 2 281 3 cyoE Protoheme IX farnesyltransferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1TWQ8 7.28e-49 167 35 1 279 3 cyoE Protoheme IX farnesyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5WDX4 1.38e-48 167 37 7 280 3 ctaB Protoheme IX farnesyltransferase Shouchella clausii (strain KSM-K16)
A7GRX3 2.08e-48 166 36 6 286 3 ctaB2 Protoheme IX farnesyltransferase 2 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B0TNS4 3.04e-48 166 35 1 279 3 cyoE Protoheme IX farnesyltransferase Shewanella halifaxensis (strain HAW-EB4)
Q8E8P7 3.09e-48 166 35 1 266 3 cyoE Protoheme IX farnesyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6HEL9 7.05e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q635Y1 7.05e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain ZK / E33L)
B7JK33 7.05e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain AH820)
Q81MT8 7.05e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus anthracis
C3LI11 7.05e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P6V2 7.05e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus anthracis (strain A0248)
C1EPV9 7.21e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain 03BB102)
B7IVI2 7.21e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain G9842)
A0RHW3 7.21e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus thuringiensis (strain Al Hakam)
Q819N1 7.28e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IW24 7.28e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain Q1)
B7HMC9 7.28e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain AH187)
B7H6T1 7.28e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain B4264)
Q732C2 7.28e-48 165 35 6 279 3 ctaB Protoheme IX farnesyltransferase Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8DHQ2 1.77e-47 164 34 2 288 3 ctaB Protoheme IX farnesyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q0HDK5 3.74e-47 162 34 1 266 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella sp. (strain MR-4)
A0L2E7 4.63e-47 162 34 1 266 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella sp. (strain ANA-3)
A4G936 6e-47 162 33 1 278 3 ctaB Protoheme IX farnesyltransferase Herminiimonas arsenicoxydans
C5BKU5 1.41e-46 161 33 1 279 3 cyoE Protoheme IX farnesyltransferase Teredinibacter turnerae (strain ATCC 39867 / T7901)
B1YN86 2.04e-46 160 35 1 279 3 ctaB Protoheme IX farnesyltransferase Burkholderia ambifaria (strain MC40-6)
B8GPF3 2.75e-46 160 33 1 279 3 cyoE Protoheme IX farnesyltransferase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0HPV6 2.97e-46 160 34 1 266 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella sp. (strain MR-7)
Q114N4 3.14e-46 161 36 1 280 3 ctaB Protoheme IX farnesyltransferase Trichodesmium erythraeum (strain IMS101)
Q0ABY1 3.41e-46 160 33 1 279 3 cyoE Protoheme IX farnesyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A9WT38 3.84e-46 160 34 2 286 3 ctaB Protoheme IX farnesyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q2SQU8 4.12e-46 160 33 1 279 3 cyoE Protoheme IX farnesyltransferase Hahella chejuensis (strain KCTC 2396)
Q6LVR2 4.33e-46 160 33 3 280 3 cyoE Protoheme IX farnesyltransferase Photobacterium profundum (strain SS9)
A1RE84 7.8e-46 159 32 1 279 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella sp. (strain W3-18-1)
Q0BBM3 1.28e-45 159 34 1 279 3 ctaB Protoheme IX farnesyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A4YC13 1.36e-45 159 32 1 279 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8H9S9 1.37e-45 159 34 1 279 3 cyoE Protoheme IX farnesyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q67ML5 1.45e-45 159 35 1 231 3 ctaB Protoheme IX farnesyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B8HMH3 2.45e-45 159 34 1 279 3 ctaB Protoheme IX farnesyltransferase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A8EZ97 3.92e-45 157 33 3 267 3 ctaB Protoheme IX farnesyltransferase Rickettsia canadensis (strain McKiel)
Q39CQ5 4.06e-45 157 34 1 279 3 ctaB Protoheme IX farnesyltransferase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B1HST2 4.37e-45 158 37 6 275 3 ctaB2 Protoheme IX farnesyltransferase 2 Lysinibacillus sphaericus (strain C3-41)
Q63XS7 5.42e-45 157 33 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia pseudomallei (strain K96243)
A3N5D1 5.42e-45 157 33 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia pseudomallei (strain 668)
Q3JWF7 5.42e-45 157 33 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia pseudomallei (strain 1710b)
A3NR29 5.42e-45 157 33 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia pseudomallei (strain 1106a)
Q5R0Y6 6.24e-45 157 32 1 279 3 cyoE Protoheme IX farnesyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1R6I0 7.08e-45 157 33 1 291 3 ctaB Protoheme IX farnesyltransferase Paenarthrobacter aurescens (strain TC1)
Q1BTD0 7.96e-45 157 34 1 279 3 ctaB Protoheme IX farnesyltransferase Burkholderia orbicola (strain AU 1054)
B1JZ41 7.96e-45 157 34 1 279 3 ctaB Protoheme IX farnesyltransferase Burkholderia orbicola (strain MC0-3)
B4EA84 7.96e-45 157 34 1 279 3 ctaB Protoheme IX farnesyltransferase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0KAR0 7.96e-45 157 34 1 279 3 ctaB Protoheme IX farnesyltransferase Burkholderia cenocepacia (strain HI2424)
A4JI25 8.13e-45 157 34 1 279 3 ctaB Protoheme IX farnesyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B0C0A5 1.06e-44 157 33 1 278 3 ctaB Protoheme IX farnesyltransferase Acaryochloris marina (strain MBIC 11017)
Q2T1F6 1.11e-44 156 33 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1LRS0 1.44e-44 156 32 1 281 3 ctaB Protoheme IX farnesyltransferase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A7GNP0 2.95e-44 155 36 5 274 3 ctaB1 Protoheme IX farnesyltransferase 1 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A1UZV8 3.02e-44 155 33 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia mallei (strain SAVP1)
Q62F61 3.02e-44 155 33 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia mallei (strain ATCC 23344)
A2S646 3.02e-44 155 33 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia mallei (strain NCTC 10229)
A3MQ44 3.02e-44 155 33 1 280 3 ctaB Protoheme IX farnesyltransferase Burkholderia mallei (strain NCTC 10247)
A3CYW8 4e-44 155 32 1 266 3 cyoE Protoheme IX farnesyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9KUX8 4e-44 155 32 1 266 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella baltica (strain OS195)
A0JWQ8 4.88e-44 155 32 1 291 3 ctaB Protoheme IX farnesyltransferase Arthrobacter sp. (strain FB24)
B2AGR8 4.95e-44 155 33 1 281 3 ctaB Protoheme IX farnesyltransferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A2SKN7 5.13e-44 155 33 2 269 3 ctaB Protoheme IX farnesyltransferase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A3Q941 5.31e-44 154 33 1 279 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B1XKB3 6.48e-44 155 34 1 281 3 ctaB Protoheme IX farnesyltransferase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A6T2T7 6.69e-44 154 32 1 278 3 ctaB Protoheme IX farnesyltransferase Janthinobacterium sp. (strain Marseille)
Q12IC7 7.82e-44 154 33 1 266 3 cyoE Protoheme IX farnesyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A6WU15 9.38e-44 154 32 1 266 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella baltica (strain OS185)
Q7NIL7 1.37e-43 154 37 0 280 3 ctaB Protoheme IX farnesyltransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q089F2 1.7e-43 153 32 1 279 3 cyoE2 Protoheme IX farnesyltransferase 2 Shewanella frigidimarina (strain NCIMB 400)
Q48AB7 2.1e-43 153 33 0 245 3 cyoE Protoheme IX farnesyltransferase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q8Y2G4 2.58e-43 153 33 1 279 3 ctaB Protoheme IX farnesyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q476H8 4.49e-43 152 31 1 281 3 ctaB Protoheme IX farnesyltransferase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B1KM58 4.75e-43 152 33 2 281 3 cyoE1 Protoheme IX farnesyltransferase 1 Shewanella woodyi (strain ATCC 51908 / MS32)
Q146A1 1.18e-42 151 34 1 279 3 ctaB Protoheme IX farnesyltransferase Paraburkholderia xenovorans (strain LB400)
B1Y6Q4 1.65e-42 150 32 3 284 3 ctaB Protoheme IX farnesyltransferase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A4XNK8 3.36e-42 150 33 1 266 3 cyoE Protoheme IX farnesyltransferase Pseudomonas mendocina (strain ymp)
Q8YYA3 5.69e-42 150 34 1 281 3 ctaB Protoheme IX farnesyltransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q0KER8 5.82e-42 149 33 1 281 3 ctaB Protoheme IX farnesyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q49WP1 6.74e-42 149 32 5 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A1SY55 1.04e-41 149 32 1 280 3 cyoE Protoheme IX farnesyltransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q4L5D0 1.16e-41 149 33 7 275 3 ctaB Protoheme IX farnesyltransferase Staphylococcus haemolyticus (strain JCSC1435)
Q3KK91 1.3e-41 148 33 1 281 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas fluorescens (strain Pf0-1)
B8H7N5 1.31e-41 149 32 2 292 3 ctaB Protoheme IX farnesyltransferase Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q5N1X0 2.12e-41 148 37 2 287 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31JY9 2.12e-41 148 37 2 287 3 ctaB Protoheme IX farnesyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q12E37 2.39e-41 147 32 2 281 3 ctaB Protoheme IX farnesyltransferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
A5UPV7 2.4e-41 152 33 2 282 3 ctaB Protoheme IX farnesyltransferase Roseiflexus sp. (strain RS-1)
Q83CV6 3.1e-41 147 37 1 228 3 cyoE Protoheme IX farnesyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NCT0 3.1e-41 147 37 1 228 3 cyoE Protoheme IX farnesyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KCC9 3.1e-41 147 37 1 228 3 cyoE Protoheme IX farnesyltransferase Coxiella burnetii (strain Dugway 5J108-111)
B6J085 3.1e-41 147 37 1 228 3 cyoE Protoheme IX farnesyltransferase Coxiella burnetii (strain CbuG_Q212)
B6J736 3.1e-41 147 37 1 228 3 cyoE Protoheme IX farnesyltransferase Coxiella burnetii (strain CbuK_Q154)
Q3MFT6 3.17e-41 148 33 1 281 3 ctaB Protoheme IX farnesyltransferase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q9ZDI2 3.72e-41 147 32 2 278 3 ctaB Protoheme IX farnesyltransferase Rickettsia prowazekii (strain Madrid E)
A7NRY4 4.05e-41 152 32 2 285 3 ctaB Protoheme IX farnesyltransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A8GN36 5.44e-41 147 35 1 232 3 ctaB Protoheme IX farnesyltransferase Rickettsia akari (strain Hartford)
Q3IJQ0 5.5e-41 147 30 1 281 3 cyoE2 Protoheme IX farnesyltransferase 2 Pseudoalteromonas translucida (strain TAC 125)
Q9I719 6.03e-41 147 33 2 283 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02UW5 6.03e-41 147 33 2 283 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q8NX68 7.27e-41 146 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain MW2)
Q6GA98 7.27e-41 146 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain MSSA476)
Q6GHW9 7.27e-41 146 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain MRSA252)
Q2YX83 7.27e-41 146 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5P2E3 8.11e-41 146 33 3 283 3 ctaB Protoheme IX farnesyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B7K336 8.42e-41 147 34 3 281 3 ctaB Protoheme IX farnesyltransferase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q4KKL2 8.63e-41 146 33 1 279 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q88RL9 9.31e-41 146 34 0 255 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8D6H2 9.67e-41 146 32 1 264 3 cyoE Protoheme IX farnesyltransferase Vibrio vulnificus (strain CMCP6)
Q2JNL3 1.04e-40 147 34 2 281 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain JA-2-3B'a(2-13))
A6UXP9 1.31e-40 145 33 2 283 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas aeruginosa (strain PA7)
Q1IGZ4 1.32e-40 145 32 1 279 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas entomophila (strain L48)
Q87IR2 1.45e-40 145 34 0 232 3 cyoE1 Protoheme IX farnesyltransferase 1 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C4K2Q8 1.62e-40 145 33 1 232 3 ctaB Protoheme IX farnesyltransferase Rickettsia peacockii (strain Rustic)
A8GVN8 1.72e-40 145 30 1 265 3 ctaB Protoheme IX farnesyltransferase Rickettsia bellii (strain OSU 85-389)
A9GEU3 2.01e-40 144 35 1 228 3 ctaB Protoheme IX farnesyltransferase Sorangium cellulosum (strain So ce56)
B9EB27 2.65e-40 145 31 5 272 3 ctaB Protoheme IX farnesyltransferase Macrococcus caseolyticus (strain JCSC5402)
A8Z1Q1 2.71e-40 145 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q7A664 2.71e-40 145 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain N315)
Q99UY7 2.71e-40 145 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QFX1 2.71e-40 145 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain Newman)
Q5HGW8 2.71e-40 145 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain COL)
A5IS03 2.71e-40 145 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain JH9)
Q2G2B9 2.71e-40 145 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHW4 2.71e-40 145 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain USA300)
A6U0T4 2.71e-40 145 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain JH1)
A7X128 2.71e-40 145 31 4 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A4T079 2.72e-40 145 31 1 279 3 ctaB Protoheme IX farnesyltransferase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1VKM6 3.04e-40 145 32 2 270 3 ctaB Protoheme IX farnesyltransferase Polaromonas naphthalenivorans (strain CJ2)
A0QWY2 3.74e-40 145 34 1 247 3 ctaB Protoheme IX farnesyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
C1DG34 4.41e-40 144 37 0 209 3 cyoE Protoheme IX farnesyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q60CP3 4.79e-40 144 32 1 279 3 cyoE Protoheme IX farnesyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q7MDC8 5.01e-40 144 32 1 264 3 cyoE Protoheme IX farnesyltransferase Vibrio vulnificus (strain YJ016)
B1XS75 5.72e-40 144 31 1 279 3 ctaB Protoheme IX farnesyltransferase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q79EF2 5.76e-40 144 34 1 280 3 ctaB Protoheme IX farnesyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1D1K4 6.1e-40 144 32 2 276 3 ctaB Protoheme IX farnesyltransferase Myxococcus xanthus (strain DK1622)
Q6AF34 9.08e-40 144 32 1 283 3 ctaB Protoheme IX farnesyltransferase Leifsonia xyli subsp. xyli (strain CTCB07)
A7N6I9 9.5e-40 144 37 2 204 3 cyoE2 Protoheme IX farnesyltransferase 2 Vibrio campbellii (strain ATCC BAA-1116)
A8FPN0 1.05e-39 143 34 0 232 3 cyoE Protoheme IX farnesyltransferase Shewanella sediminis (strain HAW-EB3)
A5VWP2 1.2e-39 143 33 0 255 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q21XT4 1.34e-39 143 32 3 273 3 ctaB Protoheme IX farnesyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q0S0I5 1.47e-39 143 33 1 249 3 ctaB Protoheme IX farnesyltransferase Rhodococcus jostii (strain RHA1)
Q3J6R6 2.12e-39 142 30 1 279 3 cyoE Protoheme IX farnesyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q1RI93 2.22e-39 142 29 1 265 3 ctaB Protoheme IX farnesyltransferase Rickettsia bellii (strain RML369-C)
B4SHI1 2.22e-39 142 32 5 290 3 cyoE Protoheme IX farnesyltransferase Stenotrophomonas maltophilia (strain R551-3)
B3CTF6 2.51e-39 142 30 3 268 3 ctaB Protoheme IX farnesyltransferase Orientia tsutsugamushi (strain Ikeda)
A1AV76 3.56e-39 142 33 1 246 3 cyoE Protoheme IX farnesyltransferase Ruthia magnifica subsp. Calyptogena magnifica
B0SMP1 3.79e-39 141 31 2 285 3 ctaB Protoheme IX farnesyltransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SE58 3.79e-39 141 31 2 285 3 ctaB Protoheme IX farnesyltransferase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q829U3 3.98e-39 142 30 1 285 3 ctaB Protoheme IX farnesyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A1WBL5 4.93e-39 142 30 3 285 3 ctaB Protoheme IX farnesyltransferase Acidovorax sp. (strain JS42)
B9MF14 4.93e-39 142 30 3 285 3 ctaB Protoheme IX farnesyltransferase Acidovorax ebreus (strain TPSY)
A5CF31 5.11e-39 142 30 2 267 3 ctaB Protoheme IX farnesyltransferase Orientia tsutsugamushi (strain Boryong)
Q2KTX0 5.26e-39 141 31 1 281 3 ctaB Protoheme IX farnesyltransferase Bordetella avium (strain 197N)
A0LTZ0 5.79e-39 141 34 0 247 3 ctaB Protoheme IX farnesyltransferase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A4FBP2 6.5e-39 142 31 2 291 3 ctaB2 Protoheme IX farnesyltransferase 2 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A1WHP5 7.27e-39 141 31 3 276 3 ctaB Protoheme IX farnesyltransferase Verminephrobacter eiseniae (strain EF01-2)
Q2JQK9 7.68e-39 142 37 1 210 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain JA-3-3Ab)
A8F1B6 8.26e-39 141 32 2 268 3 ctaB Protoheme IX farnesyltransferase Rickettsia massiliae (strain Mtu5)
B9DPV9 1.01e-38 141 31 5 272 3 ctaB Protoheme IX farnesyltransferase Staphylococcus carnosus (strain TM300)
B0KFZ0 1.16e-38 140 35 0 219 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas putida (strain GB-1)
A5CXZ0 1.17e-38 140 34 1 233 3 cyoE Protoheme IX farnesyltransferase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A1TU04 1.23e-38 140 30 3 283 3 ctaB Protoheme IX farnesyltransferase Paracidovorax citrulli (strain AAC00-1)
Q0RH20 1.25e-38 140 33 1 281 3 ctaB Protoheme IX farnesyltransferase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q5HQ51 1.38e-38 140 31 5 274 3 ctaB Protoheme IX farnesyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7VT22 1.47e-38 140 32 3 284 3 ctaB Protoheme IX farnesyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8CPM1 1.74e-38 140 31 5 274 3 ctaB Protoheme IX farnesyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q2YCM2 1.96e-38 140 31 1 279 3 ctaB Protoheme IX farnesyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1KAQ4 2.42e-38 140 34 3 266 3 ctaB Protoheme IX farnesyltransferase Azoarcus sp. (strain BH72)
Q7W316 3.88e-38 139 32 3 284 3 ctaB Protoheme IX farnesyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WE16 3.88e-38 139 32 3 284 3 ctaB Protoheme IX farnesyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9XAC2 5.24e-38 139 31 1 285 3 ctaB Protoheme IX farnesyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A8GRQ1 5.85e-38 139 33 1 232 3 ctaB Protoheme IX farnesyltransferase Rickettsia rickettsii (strain Sheila Smith)
B0BX58 5.85e-38 139 33 1 232 3 ctaB Protoheme IX farnesyltransferase Rickettsia rickettsii (strain Iowa)
B1MC66 6.25e-38 139 35 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q0ADH9 6.47e-38 139 29 1 280 3 ctaB Protoheme IX farnesyltransferase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q92IF1 7.3e-38 139 33 1 232 3 ctaB Protoheme IX farnesyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PN58 7.3e-38 139 33 1 232 3 ctaB Protoheme IX farnesyltransferase Rickettsia africae (strain ESF-5)
B1J467 8.06e-38 138 32 1 279 3 cyoE1 Protoheme IX farnesyltransferase 1 Pseudomonas putida (strain W619)
Q8P487 8.52e-38 138 31 6 291 3 cyoE Protoheme IX farnesyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RXJ1 8.52e-38 138 31 6 291 3 cyoE Protoheme IX farnesyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4UPT7 8.52e-38 138 31 6 291 3 cyoE Protoheme IX farnesyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q5GV87 1.34e-37 138 31 6 293 3 cyoE Protoheme IX farnesyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NYG1 1.34e-37 138 31 6 293 3 cyoE Protoheme IX farnesyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A5CRS6 1.72e-37 137 32 1 282 3 ctaB Protoheme IX farnesyltransferase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Q47G19 1.79e-37 137 34 1 239 3 ctaB Protoheme IX farnesyltransferase Dechloromonas aromatica (strain RCB)
Q4UM22 1.99e-37 137 33 1 232 3 ctaB Protoheme IX farnesyltransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q5YTS1 2.1e-37 137 34 1 247 3 ctaB Protoheme IX farnesyltransferase Nocardia farcinica (strain IFM 10152)
B0REI2 3.38e-37 137 31 1 282 3 ctaB Protoheme IX farnesyltransferase Clavibacter sepedonicus
Q3BND5 5.14e-37 136 31 6 293 3 cyoE Protoheme IX farnesyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PFU4 5.77e-37 136 32 6 293 3 cyoE Protoheme IX farnesyltransferase Xanthomonas axonopodis pv. citri (strain 306)
B3CN58 6.3e-37 136 31 4 274 3 ctaB Protoheme IX farnesyltransferase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q7P0G0 8.82e-37 135 33 1 275 3 ctaB1 Protoheme IX farnesyltransferase 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2JCG7 1.04e-36 135 32 2 282 3 ctaB Protoheme IX farnesyltransferase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
A8KYS6 1.43e-36 135 33 5 271 3 ctaB Protoheme IX farnesyltransferase Parafrankia sp. (strain EAN1pec)
A7HQW1 2.55e-36 135 29 4 275 3 ctaB Protoheme IX farnesyltransferase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q2GDE4 2.89e-36 134 30 2 285 3 ctaB Protoheme IX farnesyltransferase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q8F9F8 3.52e-36 134 31 5 282 3 ctaB Protoheme IX farnesyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72VU2 3.52e-36 134 31 5 282 3 ctaB Protoheme IX farnesyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
B1W108 4.16e-36 134 31 2 286 3 ctaB Protoheme IX farnesyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
A1SBD7 5.3e-36 134 33 0 239 3 cyoE Protoheme IX farnesyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B7KHX2 5.33e-36 134 33 4 287 3 ctaB Protoheme IX farnesyltransferase Gloeothece citriformis (strain PCC 7424)
A9HWL4 6.06e-36 133 32 1 281 3 ctaB Protoheme IX farnesyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q82VQ6 1.26e-35 132 29 1 279 3 ctaB Protoheme IX farnesyltransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q2IPE5 1.36e-35 132 34 5 281 3 ctaB Protoheme IX farnesyltransferase Anaeromyxobacter dehalogenans (strain 2CP-C)
A6WC46 1.57e-35 133 30 1 297 3 ctaB Protoheme IX farnesyltransferase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q055W1 2.56e-35 131 31 5 279 3 ctaB Protoheme IX farnesyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PG4 2.56e-35 131 31 5 279 3 ctaB Protoheme IX farnesyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A0PPP7 3.25e-35 132 34 3 248 3 ctaB Protoheme IX farnesyltransferase Mycobacterium ulcerans (strain Agy99)
Q9CCN4 3.61e-35 132 32 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacterium leprae (strain TN)
P9WFR7 4.01e-35 131 33 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFR6 4.01e-35 131 33 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1QRH1 4.01e-35 131 33 1 247 3 ctaB1 Protoheme IX farnesyltransferase Mycobacterium tuberculosis (strain F11)
A5U2F4 4.01e-35 131 33 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
B9JAP1 4.73e-35 132 29 2 269 3 ctaB Protoheme IX farnesyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q2KBM1 6.54e-35 131 28 2 269 3 ctaB Protoheme IX farnesyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q5HAA6 6.75e-35 130 29 2 268 3 ctaB Protoheme IX farnesyltransferase Ehrlichia ruminantium (strain Welgevonden)
Q741B3 7.15e-35 131 32 1 247 3 ctaB Protoheme IX farnesyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q83GF8 7.47e-35 130 32 2 242 3 ctaB Protoheme IX farnesyltransferase Tropheryma whipplei (strain Twist)
Q83NK0 7.47e-35 130 32 2 242 3 ctaB Protoheme IX farnesyltransferase Tropheryma whipplei (strain TW08/27)
Q3YR13 8.42e-35 130 29 4 267 3 ctaB Protoheme IX farnesyltransferase Ehrlichia canis (strain Jake)
A8LW09 8.51e-35 131 36 0 207 3 ctaB Protoheme IX farnesyltransferase Salinispora arenicola (strain CNS-205)
Q9PDL9 9.14e-35 130 32 6 292 3 cyoE Protoheme IX farnesyltransferase Xylella fastidiosa (strain 9a5c)
Q1B9B1 9.82e-35 130 33 1 248 3 ctaB Protoheme IX farnesyltransferase Mycobacterium sp. (strain MCS)
A1UFQ0 9.82e-35 130 33 1 248 3 ctaB Protoheme IX farnesyltransferase Mycobacterium sp. (strain KMS)
A3PZB2 9.82e-35 130 33 1 248 3 ctaB Protoheme IX farnesyltransferase Mycobacterium sp. (strain JLS)
Q5FGC3 9.97e-35 130 29 2 266 3 ctaB Protoheme IX farnesyltransferase Ehrlichia ruminantium (strain Gardel)
C1AN96 1.32e-34 130 33 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KIP0 1.32e-34 130 33 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U021 1.32e-34 130 33 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B3PSB2 1.35e-34 130 28 2 269 3 ctaB Protoheme IX farnesyltransferase Rhizobium etli (strain CIAT 652)
Q87DT0 2.16e-34 129 31 6 294 3 cyoE Protoheme IX farnesyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B5ZSV2 3.26e-34 129 29 2 269 3 ctaB Protoheme IX farnesyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MKI5 6.24e-34 129 29 2 269 3 ctaB Protoheme IX farnesyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A4TC38 6.85e-34 128 31 2 288 3 ctaB Protoheme IX farnesyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
B0JGA8 8.91e-34 128 33 1 280 3 ctaB Protoheme IX farnesyltransferase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
C0R2X3 1.1e-33 127 28 4 274 3 ctaB Protoheme IX farnesyltransferase Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q1J1C3 1.15e-33 127 32 0 234 3 ctaB Protoheme IX farnesyltransferase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A0QHX0 1.63e-33 127 32 1 247 3 ctaB Protoheme IX farnesyltransferase Mycobacterium avium (strain 104)
A5FJD0 1.68e-33 127 32 6 285 3 ctaB Protoheme IX farnesyltransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A4X9F8 1.69e-33 127 37 0 207 3 ctaB Protoheme IX farnesyltransferase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q1GTA5 2.1e-33 127 30 4 270 3 ctaB Protoheme IX farnesyltransferase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
B0T0X6 2.23e-33 128 31 1 234 3 ctaB Protoheme IX farnesyltransferase Caulobacter sp. (strain K31)
Q2GFJ2 3.75e-33 126 30 1 220 3 ctaB Protoheme IX farnesyltransferase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q3SLW5 4.09e-33 126 32 1 279 3 ctaB Protoheme IX farnesyltransferase Thiobacillus denitrificans (strain ATCC 25259)
A6U6U6 5.01e-33 126 27 3 286 3 ctaB Protoheme IX farnesyltransferase Sinorhizobium medicae (strain WSM419)
Q0BPU7 6.37e-33 126 28 3 280 3 ctaB Protoheme IX farnesyltransferase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q01YC2 8.13e-33 125 30 5 292 3 ctaB Protoheme IX farnesyltransferase Solibacter usitatus (strain Ellin6076)
A1T8M8 9.1e-33 125 31 1 247 3 ctaB Protoheme IX farnesyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q13CY5 1.04e-32 125 29 2 281 3 ctaB Protoheme IX farnesyltransferase Rhodopseudomonas palustris (strain BisB5)
C3MHJ3 1.31e-32 125 28 3 282 3 ctaB Protoheme IX farnesyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q73I75 2.3e-32 124 28 2 271 3 ctaB Protoheme IX farnesyltransferase Wolbachia pipientis wMel
Q6G4C6 2.9e-32 124 30 5 269 3 ctaB Protoheme IX farnesyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A9HKH7 2.93e-32 124 30 6 277 3 ctaB Protoheme IX farnesyltransferase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A6WWG0 4.5e-32 124 29 6 294 3 ctaB Protoheme IX farnesyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
C0RHH6 4.89e-32 124 29 6 280 3 ctaB Protoheme IX farnesyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8Z3 4.89e-32 124 29 6 280 3 ctaB Protoheme IX farnesyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q5GSX9 4.94e-32 123 28 1 208 3 ctaB Protoheme IX farnesyltransferase Wolbachia sp. subsp. Brugia malayi (strain TRS)
P67054 5.11e-32 123 29 6 280 3 ctaB Protoheme IX farnesyltransferase Brucella suis biovar 1 (strain 1330)
A5VP40 5.11e-32 123 29 6 280 3 ctaB Protoheme IX farnesyltransferase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P67053 5.11e-32 123 29 6 280 3 ctaB Protoheme IX farnesyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
B0CKF4 5.43e-32 123 29 6 280 3 ctaB Protoheme IX farnesyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8NQ66 5.92e-32 124 29 5 291 3 ctaB Protoheme IX farnesyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QEE9 5.92e-32 124 29 5 291 3 ctaB Protoheme IX farnesyltransferase Corynebacterium glutamicum (strain R)
A5EA98 1.7e-31 122 29 5 287 3 ctaB Protoheme IX farnesyltransferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q2IR91 2e-31 122 30 2 274 3 ctaB Protoheme IX farnesyltransferase Rhodopseudomonas palustris (strain HaA2)
A4Z2D2 2.6e-31 121 29 3 282 3 ctaB Protoheme IX farnesyltransferase Bradyrhizobium sp. (strain ORS 278)
Q92RG8 3.03e-31 121 26 3 286 3 ctaB Protoheme IX farnesyltransferase Rhizobium meliloti (strain 1021)
Q8FT77 3.16e-31 122 29 2 229 3 ctaB Protoheme IX farnesyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A7H8V9 5.72e-31 120 31 3 276 3 ctaB Protoheme IX farnesyltransferase Anaeromyxobacter sp. (strain Fw109-5)
A1URX1 5.87e-31 120 31 2 216 3 ctaB Protoheme IX farnesyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A1SJR1 6.56e-31 120 29 2 299 3 ctaB Protoheme IX farnesyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q0AMG9 6.76e-31 121 31 1 211 3 ctaB Protoheme IX farnesyltransferase Maricaulis maris (strain MCS10)
B7KVJ7 7.19e-31 120 32 2 222 3 ctaB Protoheme IX farnesyltransferase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q07HB2 1.04e-30 120 30 2 269 3 ctaB Protoheme IX farnesyltransferase Rhodopseudomonas palustris (strain BisA53)
Q9RR78 1.29e-30 120 31 3 238 3 ctaB Protoheme IX farnesyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q5SLI3 1.32e-30 124 34 0 211 3 ctaB Protoheme IX farnesyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72H22 1.45e-30 124 34 0 211 3 ctaB Protoheme IX farnesyltransferase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B1ZKN8 1.46e-30 120 32 2 222 3 ctaB Protoheme IX farnesyltransferase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9IQQ6 2.71e-30 119 30 2 217 3 ctaB Protoheme IX farnesyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6G0D0 3.86e-30 118 32 2 218 3 ctaB Protoheme IX farnesyltransferase Bartonella quintana (strain Toulouse)
A4F9B0 3.94e-30 118 33 1 245 3 ctaB1 Protoheme IX farnesyltransferase 1 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A5VD56 4.7e-30 118 31 2 231 3 ctaB Protoheme IX farnesyltransferase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A9CJX3 1.49e-29 117 30 1 238 3 ctaB Protoheme IX farnesyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6NBJ5 1.54e-29 117 28 2 281 3 ctaB Protoheme IX farnesyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q9RM98 2.09e-29 116 29 3 275 3 ctaB Protoheme IX farnesyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6NH44 4.62e-29 115 30 4 290 3 ctaB Protoheme IX farnesyltransferase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q5P9Y8 5.3e-29 115 32 2 210 3 ctaB Protoheme IX farnesyltransferase Anaplasma marginale (strain St. Maries)
B9KGP6 5.3e-29 115 32 2 210 3 ctaB Protoheme IX farnesyltransferase Anaplasma marginale (strain Florida)
B2IGJ6 6.65e-29 115 29 4 272 3 ctaB Protoheme IX farnesyltransferase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A8IDL3 8.23e-29 115 29 3 270 3 ctaB Protoheme IX farnesyltransferase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B0UFS2 1.09e-28 115 33 1 186 3 ctaB Protoheme IX farnesyltransferase Methylobacterium sp. (strain 4-46)
Q6A7G0 1.27e-28 115 35 2 229 3 ctaB Protoheme IX farnesyltransferase Cutibacterium acnes (strain DSM 16379 / KPA171202)
B6JDB7 1.28e-28 114 31 1 219 3 ctaB Protoheme IX farnesyltransferase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q985X0 1.31e-28 114 32 0 186 3 ctaB2 Protoheme IX farnesyltransferase 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2S012 1.79e-28 113 29 6 291 3 ctaB Protoheme IX farnesyltransferase Salinibacter ruber (strain DSM 13855 / M31)
Q3IRC9 2.26e-28 116 30 3 243 3 ctaB1 Protoheme IX farnesyltransferase 1 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q6MR11 2.51e-28 113 33 4 224 3 ctaB Protoheme IX farnesyltransferase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A6H1E4 3.1e-28 113 30 7 289 3 ctaB Protoheme IX farnesyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q39Z26 5.52e-28 112 32 4 214 3 ctaB Protoheme IX farnesyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q11SZ7 6.3e-28 112 33 1 187 3 ctaB Protoheme IX farnesyltransferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q9A301 7.65e-28 113 29 1 234 3 ctaB Protoheme IX farnesyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q47ND5 7.69e-28 112 30 1 286 3 ctaB Protoheme IX farnesyltransferase Thermobifida fusca (strain YX)
Q2NCF2 9.48e-28 112 28 1 211 3 ctaB Protoheme IX farnesyltransferase Erythrobacter litoralis (strain HTCC2594)
B8I9Q3 1.01e-27 112 35 1 187 3 ctaB Protoheme IX farnesyltransferase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q5FPU4 1.64e-27 111 27 2 256 3 ctaB Protoheme IX farnesyltransferase Gluconobacter oxydans (strain 621H)
Q28MJ1 2.03e-27 111 30 1 233 3 ctaB Protoheme IX farnesyltransferase Jannaschia sp. (strain CCS1)
Q20X25 2.05e-27 111 29 2 269 3 ctaB Protoheme IX farnesyltransferase Rhodopseudomonas palustris (strain BisB18)
A4WQ57 2.15e-27 111 32 2 213 3 ctaB Protoheme IX farnesyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B9KLZ5 2.36e-27 111 31 2 213 3 ctaB Protoheme IX farnesyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q98LF1 4.24e-27 110 31 2 216 3 ctaB1 Protoheme IX farnesyltransferase 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A5G0I2 4.26e-27 110 30 1 229 3 ctaB Protoheme IX farnesyltransferase Acidiphilium cryptum (strain JF-5)
Q3J5F9 4.48e-27 110 31 2 213 1 ctaB Protoheme IX farnesyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGX5 4.48e-27 110 31 2 213 3 ctaB Protoheme IX farnesyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q11KD2 4.71e-27 110 27 1 229 3 ctaB Protoheme IX farnesyltransferase Chelativorans sp. (strain BNC1)
Q8CFY5 6.25e-27 112 30 6 265 2 Cox10 Protoheme IX farnesyltransferase, mitochondrial Mus musculus
Q12887 6.57e-27 112 32 5 225 1 COX10 Protoheme IX farnesyltransferase, mitochondrial Homo sapiens
Q74GM3 7.28e-27 108 33 5 230 3 ctaB Protoheme IX farnesyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q18JU9 1.05e-26 112 30 2 213 3 ctaB Protoheme IX farnesyltransferase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q5LNX8 1.24e-26 109 34 1 187 3 ctaB Protoheme IX farnesyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q1QHV7 1.73e-26 108 28 3 270 3 ctaB1 Protoheme IX farnesyltransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q3SUL3 1.79e-26 108 29 4 271 3 ctaB2 Protoheme IX farnesyltransferase 2 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q3SW48 1.79e-26 108 29 4 271 3 ctaB1 Protoheme IX farnesyltransferase 1 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q0C3D1 2.32e-26 108 28 2 233 3 ctaB Protoheme IX farnesyltransferase Hyphomonas neptunium (strain ATCC 15444)
P56938 2.53e-26 107 30 1 213 3 ctaB Protoheme IX farnesyltransferase Cereibacter sphaeroides
Q2GJ17 2.67e-26 108 29 3 219 3 ctaB Protoheme IX farnesyltransferase Anaplasma phagocytophilum (strain HZ)
B1I6G5 2.71e-26 108 29 3 281 3 ctaB Protoheme IX farnesyltransferase Desulforudis audaxviator (strain MP104C)
B1ZMT0 3.39e-26 107 31 8 270 3 ctaB Protoheme IX farnesyltransferase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q1GE49 3.7e-26 108 30 1 207 3 ctaB Protoheme IX farnesyltransferase Ruegeria sp. (strain TM1040)
B1M595 3.9e-26 108 31 6 284 3 ctaB Protoheme IX farnesyltransferase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B8EPK3 4.89e-26 107 30 2 227 3 ctaB Protoheme IX farnesyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q5R460 5.66e-26 109 36 2 161 2 COX10 Protoheme IX farnesyltransferase, mitochondrial Pongo abelii
A3MXH2 6.39e-26 106 32 1 199 3 ctaB1 Protoheme IX farnesyltransferase 1 Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q167W1 6.49e-26 107 32 0 174 3 ctaB Protoheme IX farnesyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A1RRA6 1.23e-25 105 33 2 212 3 ctaB Protoheme IX farnesyltransferase Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
A0LXT1 5.33e-25 104 28 6 286 3 ctaB Protoheme IX farnesyltransferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q4FPD2 5.51e-25 104 24 2 281 3 ctaB Protoheme IX farnesyltransferase Pelagibacter ubique (strain HTCC1062)
O28243 7.51e-25 103 30 8 270 3 ctaB Protoheme IX farnesyltransferase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q6L147 1.01e-24 103 37 0 143 3 ctaB1 Protoheme IX farnesyltransferase 1 Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
A9WAQ6 1.15e-24 107 30 2 232 3 ctaB Protoheme IX farnesyltransferase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q4JVK2 1.18e-24 103 31 3 231 3 ctaB Protoheme IX farnesyltransferase Corynebacterium jeikeium (strain K411)
Q5V5S6 4.39e-24 104 30 2 205 3 ctaB Protoheme IX farnesyltransferase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q2W9D1 4.57e-24 101 32 2 199 3 ctaB1 Protoheme IX farnesyltransferase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A1BA40 8.76e-24 101 32 1 187 3 ctaB Protoheme IX farnesyltransferase Paracoccus denitrificans (strain Pd 1222)
Q3AV04 9.68e-24 101 31 0 210 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain CC9902)
A8LHT6 9.7e-24 101 34 2 200 3 ctaB Protoheme IX farnesyltransferase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q2G9W3 1.27e-23 100 27 1 230 3 ctaB Protoheme IX farnesyltransferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q0I891 1.67e-23 101 29 2 271 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain CC9311)
Q3ALZ8 2.47e-23 100 30 0 210 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain CC9605)
Q7U550 2.59e-23 100 30 0 210 3 ctaB Protoheme IX farnesyltransferase Parasynechococcus marenigrum (strain WH8102)
Q1IPI1 3.43e-23 100 28 8 296 3 ctaB Protoheme IX farnesyltransferase Koribacter versatilis (strain Ellin345)
A5GMY0 4.05e-23 100 30 1 225 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain WH7803)
A3MXJ5 4.28e-23 99 29 3 264 3 ctaB2 Protoheme IX farnesyltransferase 2 Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
B1YB28 5.1e-23 99 32 2 205 3 ctaB Protoheme IX farnesyltransferase Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)
A5GRR8 1.17e-22 99 28 1 269 3 ctaB Protoheme IX farnesyltransferase Synechococcus sp. (strain RCC307)
P08301 2.42e-22 97 30 3 189 3 ctaB Protoheme IX farnesyltransferase Paracoccus denitrificans
B0R3W4 2.79e-22 99 31 3 231 3 ctaB Protoheme IX farnesyltransferase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9HRJ8 3.45e-22 99 31 3 231 3 ctaB Protoheme IX farnesyltransferase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q979K5 4.45e-22 96 30 5 218 3 ctaB Protoheme IX farnesyltransferase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
A4WIG5 5.07e-22 96 30 1 203 3 ctaB Protoheme IX farnesyltransferase Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6)
Q8ZST3 5.77e-22 95 32 5 199 3 ctaB2 Protoheme IX farnesyltransferase 2 Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q9Y7Y4 8.56e-22 97 27 5 266 3 cox10 Protoheme IX farnesyltransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9YAR5 8.98e-22 95 30 8 275 3 ctaB Protoheme IX farnesyltransferase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q8ZXD4 9.47e-22 95 32 5 199 3 ctaB1 Protoheme IX farnesyltransferase 1 Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
A0RUY7 4.48e-21 94 30 3 213 3 ctaB1 Protoheme IX farnesyltransferase 1 Cenarchaeum symbiosum (strain A)
Q7VDD5 4.54e-21 94 27 2 291 3 ctaB Protoheme IX farnesyltransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q3INR7 9.27e-21 94 28 3 259 3 ctaB2 Protoheme IX farnesyltransferase 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q9UX46 1.1e-20 92 28 1 207 3 ctaB Protoheme IX farnesyltransferase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
A0RZ28 2.22e-20 92 31 9 298 3 ctaB2 Protoheme IX farnesyltransferase 2 Cenarchaeum symbiosum (strain A)
C3NH36 4.45e-20 90 28 1 207 3 ctaB Protoheme IX farnesyltransferase Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18420
Feature type CDS
Gene cyoE
Product heme o synthase
Location 1437 - 2321 (strand: -1)
Length 885 (nucleotides) / 294 (amino acids)
In genomic island -

Contig

Accession ZDB_237
Length 30268 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2139
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01040 UbiA prenyltransferase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0109 Coenzyme transport and metabolism (H)
Lipid transport and metabolism (I)
HI Polyprenyltransferase (heme O synthase)

Kegg Ortholog Annotation(s)

Protein Sequence

MMKQYLQVTKPGIIFGNLISVVGGFLLASKGDIDYPLFIATLLGVSLVVASGCVFNNYIDRDIDSVMERTKNRPLVRGLIDPKISLVYASVLGIAGMVLLLVAANAVAMLIAVVGFVVYVGVYSLYMKRKSVYGTLVGSLSGAAPPVIGYCAVTGQFDTGALILLLIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVIKGISVAKNHIILYIIAFMFATLMLAISGYAGYKYLIVAAAVSVWWLGMALSGYKTTNDRVWARKLFVFSIVAITSLSVMMSVDPSVSGDVLLAYSR

Flanking regions ( +/- flanking 50bp)

ATTATGTACAACCTGAACATCAATATGATGGTTGATTAAGAGTTGCCGATATGATGAAGCAATACCTGCAAGTGACCAAACCGGGAATTATTTTCGGAAATTTAATTTCTGTGGTCGGGGGATTCCTGCTCGCCTCCAAAGGTGACATTGATTACCCTCTGTTCATTGCGACATTGCTCGGTGTCTCGCTGGTCGTGGCCTCCGGTTGTGTTTTTAACAATTACATTGACCGCGACATCGACTCCGTCATGGAACGCACGAAAAACCGCCCTCTGGTAAGAGGGCTTATTGACCCGAAAATCAGTCTGGTTTATGCCTCTGTGCTGGGTATTGCCGGCATGGTGCTGCTGTTAGTGGCAGCCAATGCGGTGGCAATGCTGATTGCTGTTGTCGGCTTTGTGGTTTATGTCGGGGTTTACAGCCTGTACATGAAACGCAAATCAGTCTACGGCACACTGGTCGGCAGTCTGTCCGGTGCCGCACCGCCGGTTATCGGCTACTGCGCGGTGACAGGCCAGTTTGATACCGGCGCACTGATCCTGCTGTTAATCTTCAGTTTATGGCAGATGCCGCACTCCTATGCGATTGCCATCTTCCGTTTCAAAGATTACCAGGCGGCCAATATCCCTGTACTGCCGGTGATTAAAGGTATTTCTGTGGCGAAAAACCACATTATCCTGTACATCATCGCCTTTATGTTTGCCACACTGATGCTCGCCATCAGCGGGTATGCGGGATATAAGTACCTGATTGTCGCCGCAGCGGTCAGTGTCTGGTGGCTGGGCATGGCGTTATCGGGCTATAAGACAACCAATGATCGTGTCTGGGCGCGTAAGTTGTTCGTGTTCTCCATTGTCGCTATCACGTCACTCAGTGTGATGATGTCTGTTGACCCCAGCGTCTCCGGTGATGTTCTGCTGGCCTACAGTCGTTAACACACACTTTCTGTAATAACAAAATGGCAGGGCTCCCCTGCCATTTTGTG