Homologs in group_3668

Help

3 homologs were identified in 3 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20545 FBDBKF_20545 100.0 Morganella morganii S1 dfrA12 trimethoprim-resistant dihydrofolate reductase DfrA12
LHKJJB_19825 LHKJJB_19825 100.0 Morganella morganii S3 dfrA12 trimethoprim-resistant dihydrofolate reductase DfrA12
HKOGLL_19695 HKOGLL_19695 100.0 Morganella morganii S5 dfrA12 trimethoprim-resistant dihydrofolate reductase DfrA12

Distribution of the homologs in the orthogroup group_3668

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3668

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q59408 5.85e-98 282 82 0 165 3 dfrA13 Dihydrofolate reductase type A13 Escherichia coli
P11045 1.54e-40 137 39 3 161 1 dfrA Dihydrofolate reductase Bacillus subtilis (strain 168)
Q54277 1.68e-33 119 33 1 142 1 dfrD Dihydrofolate reductase Staphylococcus haemolyticus
P04174 5.81e-32 115 44 2 137 1 folA Dihydrofolate reductase Neisseria gonorrhoeae
P43791 3.15e-31 113 38 2 142 3 folA Dihydrofolate reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P12833 8.85e-30 109 41 1 127 1 dhfrIII Dihydrofolate reductase type 3 Salmonella typhimurium
P27422 3.67e-29 107 38 3 158 3 dhfrVII Dihydrofolate reductase type 7 Escherichia coli
Q9JSQ9 5.11e-28 105 44 2 138 3 folA Dihydrofolate reductase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K168 6.7e-28 104 44 2 138 3 folA Dihydrofolate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q89AV2 1.04e-27 104 36 1 129 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P11731 1.07e-27 103 37 3 158 1 dhfrV Dihydrofolate reductase type 5 Escherichia coli
P9WNX1 1.94e-27 103 40 3 136 1 folA Dihydrofolate reductase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNX0 1.94e-27 103 40 3 136 3 folA Dihydrofolate reductase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A547 1.94e-27 103 40 3 136 3 folA Dihydrofolate reductase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P31074 1.96e-27 103 38 3 153 3 folA Dihydrofolate reductase Klebsiella aerogenes
P0C0P1 1.19e-26 101 33 2 160 3 folA Dihydrofolate reductase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPB1 1.19e-26 101 33 2 160 3 folA Dihydrofolate reductase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0C0P0 1.19e-26 101 33 2 160 1 folA Dihydrofolate reductase Staphylococcus epidermidis
P95524 1.36e-26 101 34 3 158 3 dhfrVI Dihydrofolate reductase type 6 Proteus mirabilis
P13955 1.65e-26 101 33 2 160 1 dfrA Dihydrofolate reductase type 1 from Tn4003 Staphylococcus aureus
P0ABQ6 7.24e-26 99 36 3 153 3 folA Dihydrofolate reductase Shigella flexneri
P0ABQ4 7.24e-26 99 36 3 153 1 folA Dihydrofolate reductase Escherichia coli (strain K12)
P0ABQ5 7.24e-26 99 36 3 153 3 folA Dihydrofolate reductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P00380 4.59e-25 97 33 2 137 1 folA Dihydrofolate reductase Enterococcus faecium
P31073 7.05e-25 97 37 2 151 3 folA Dihydrofolate reductase Citrobacter freundii
Q5V600 7.69e-25 97 36 4 161 3 folA2 Dihydrofolate reductase 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P00382 4.18e-24 94 31 3 158 1 dhfrI Dihydrofolate reductase type 1 Escherichia coli
P78218 8.98e-24 94 32 3 158 3 dhfrXV Dihydrofolate reductase type 15 Escherichia coli
P57243 9.42e-24 94 33 5 160 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P0A017 1.9e-23 93 32 1 137 1 folA Dihydrofolate reductase Staphylococcus aureus
Q6GGY1 1.9e-23 93 32 1 137 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MRSA252)
P99079 1.9e-23 93 32 1 137 1 folA Dihydrofolate reductase Staphylococcus aureus (strain N315)
P0A016 1.9e-23 93 32 1 137 3 folA Dihydrofolate reductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFZ7 1.9e-23 93 32 1 137 3 folA Dihydrofolate reductase Staphylococcus aureus (strain COL)
Q8NWQ9 3.09e-23 92 32 1 137 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MW2)
Q6G9D5 3.09e-23 92 32 1 137 3 folA Dihydrofolate reductase Staphylococcus aureus (strain MSSA476)
Q9UWQ4 5.29e-23 93 40 3 142 1 hdrB Dihydrofolate reductase HdrB Haloferax volcanii
P15093 6.63e-23 92 37 3 136 1 hdrA Dihydrofolate reductase HdrA Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q9CBW1 2.19e-21 88 37 4 137 3 folA Dihydrofolate reductase Mycobacterium leprae (strain TN)
P00381 3.1e-21 87 33 3 159 1 folA Dihydrofolate reductase Lacticaseibacillus casei
Q59487 3.44e-19 82 31 3 131 3 folA Dihydrofolate reductase Lactococcus lactis subsp. lactis (strain IL1403)
Q8K9Z8 4.63e-19 82 34 3 137 3 folA Dihydrofolate reductase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P28019 5.09e-19 82 31 10 182 3 DHFR Dihydrofolate reductase Aedes albopictus
Q54801 2.18e-18 80 27 3 161 1 dhfR Dihydrofolate reductase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0ABQ8 9.08e-18 79 34 3 138 3 dhfrVIII Dihydrofolate reductase type 8 Shigella sonnei
P0ABQ7 9.08e-18 79 34 3 138 3 dhfrVIII Dihydrofolate reductase type 8 Escherichia coli
Q5V3R2 5.7e-16 74 31 2 157 3 folA1 Dihydrofolate reductase 1 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P00378 8.55e-16 74 33 8 154 1 DHFR Dihydrofolate reductase Gallus gallus
P45350 1.3e-15 76 32 7 179 2 None Bifunctional dihydrofolate reductase-thymidylate synthase Daucus carota
Q9U8B8 2.15e-15 73 28 6 182 1 DHFR Dihydrofolate reductase Heliothis virescens
P17719 3.3e-15 72 29 5 150 1 Dhfr Dihydrofolate reductase Drosophila melanogaster
O62583 2.36e-14 70 29 4 158 3 DHFR-1 Dihydrofolate reductase Encephalitozoon cuniculi (strain GB-M1)
P00377 2.48e-14 70 30 10 180 1 DHFR Dihydrofolate reductase Sus scrofa
P00374 3.09e-14 70 30 9 180 1 DHFR Dihydrofolate reductase Homo sapiens
Q920D2 3.58e-14 69 30 9 180 1 Dhfr Dihydrofolate reductase Rattus norvegicus
P00376 6.99e-14 68 32 8 153 1 DHFR Dihydrofolate reductase Bos taurus
P04753 9.08e-14 68 29 9 179 2 DHFR Dihydrofolate reductase Mesocricetus auratus
P00375 1.48e-13 68 29 9 180 1 Dhfr Dihydrofolate reductase Mus musculus
P51820 1.56e-13 70 29 8 179 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Glycine max
P78028 1.58e-13 67 27 3 140 3 folA Dihydrofolate reductase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
G4VJD6 1.78e-13 67 28 4 163 1 DHFR Dihydrofolate reductase Schistosoma mansoni
Q2QRX6 2.41e-13 70 29 5 142 3 Os12g0446900 Putative bifunctional dihydrofolate reductase-thymidylate synthase Oryza sativa subsp. japonica
Q27828 2.56e-13 69 36 4 119 3 GSPATT00019973001 Bifunctional dihydrofolate reductase-thymidylate synthase Paramecium tetraurelia
P47470 3.2e-13 66 27 4 144 3 folA Dihydrofolate reductase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q93341 3.3e-13 67 30 5 163 3 dhfr-1 Putative dihydrofolate reductase Caenorhabditis elegans
O81395 2.86e-12 67 27 6 157 2 DRTS Bifunctional dihydrofolate reductase-thymidylate synthase Zea mays
P16184 4.6e-12 64 30 5 150 1 None Dihydrofolate reductase Pneumocystis carinii
P09503 7.38e-12 63 27 9 180 3 DHFR Viral dihydrofolate reductase Saimiriine herpesvirus 2 (strain 11)
Q98Q32 9e-12 63 28 1 125 3 folA Dihydrofolate reductase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q86XF0 1.32e-11 63 31 9 153 1 DHFR2 Dihydrofolate reductase 2, mitochondrial Homo sapiens
Q05763 7e-11 62 28 7 163 2 THY-2 Bifunctional dihydrofolate reductase-thymidylate synthase 2 Arabidopsis thaliana
P22573 1.09e-10 60 27 8 177 3 DHFR Viral dihydrofolate reductase Saimiriine herpesvirus 2 (strain 488)
P07807 2.58e-10 60 34 5 119 1 DFR1 Dihydrofolate reductase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q05762 3.18e-10 60 28 7 163 1 THY-1 Bifunctional dihydrofolate reductase-thymidylate synthase 1 Arabidopsis thaliana
Q07801 1.34e-09 58 29 6 174 1 DFR1 Dihydrofolate reductase Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Q59397 1.45e-09 57 29 2 143 3 dhfrIX Dihydrofolate reductase type 9 Escherichia coli
P22906 1.22e-08 55 27 7 151 1 DFR1 Dihydrofolate reductase Candida albicans
P36591 5.21e-08 54 26 7 163 2 dfr1 Dihydrofolate reductase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P13922 5.44e-08 54 29 4 113 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium falciparum (isolate K1 / Thailand)
Q9PR30 1.45e-07 51 23 2 124 3 folA Dihydrofolate reductase Ureaplasma parvum serovar 3 (strain ATCC 700970)
P16126 5.25e-07 51 26 8 188 3 None Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania amazonensis
Q27793 7.33e-07 51 42 3 76 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma cruzi
Q27783 7.63e-07 51 34 4 103 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Trypanosoma brucei brucei
Q7NB76 1.31e-06 50 28 4 152 3 scpA Segregation and condensation protein A Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
P04382 2.22e-06 48 26 5 171 1 frd Dihydrofolate reductase Enterobacteria phage T4
O02604 2.29e-06 49 27 3 113 1 None Bifunctional dihydrofolate reductase-thymidylate synthase Plasmodium vivax
P07382 3.51e-05 46 33 3 84 1 LmjF06.0860 Bifunctional dihydrofolate reductase-thymidylate synthase Leishmania major
Q04515 5.53e-05 45 25 5 153 3 dfrA10 Dihydrofolate reductase type A10 Escherichia coli
P75478 8.49e-05 45 29 2 92 3 scpA Segregation and condensation protein A Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q60034 0.000274 42 29 5 141 1 folA Dihydrofolate reductase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_19860
Feature type CDS
Gene dfrA12
Product trimethoprim-resistant dihydrofolate reductase DfrA12
Location 155 - 652 (strand: 1)
Length 498 (nucleotides) / 165 (amino acids)
In genomic island -

Contig

Accession ZDB_563
Length 2484 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3668
Orthogroup size 4
N. genomes 4

Actions

Genomic region

Domains

PF00186 Dihydrofolate reductase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0262 Coenzyme transport and metabolism (H) H Dihydrofolate reductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18590 dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3] One carbon pool by folate
Folate biosynthesis
Metabolic pathways
-

AMR gene Annotation(s)

Gene Description Scope Type Class Subclass HMM
dfrA12 trimethoprim-resistant dihydrofolate reductase DfrA12 core AMR TRIMETHOPRIM TRIMETHOPRIM NF000053 

Protein Sequence

MNSESVRIYLVAAMGANRVIGNGPNIPWKIPGEQKIFRRLTEGKVVVMGRKTFESIGKPLPNRHTLVISRQANYRATGCVVVSTLSHAIALASELGNELYVAGGAEIYTLALPHAHGVFLSEVHQTFEGDAFFPMLNETEFELVSTETIQAVIPYTHSVYARRNG

Flanking regions ( +/- flanking 50bp)

AGCAACGATGTTACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAGCCATATGAACTCGGAATCAGTACGCATTTATCTCGTTGCTGCGATGGGAGCCAATCGGGTTATTGGCAATGGTCCTAATATCCCCTGGAAAATTCCGGGTGAGCAGAAGATTTTTCGCAGACTCACTGAGGGAAAAGTCGTTGTCATGGGGCGAAAGACCTTTGAGTCTATCGGCAAGCCTCTACCGAACCGTCACACATTGGTAATCTCACGCCAAGCTAACTACCGCGCCACTGGCTGCGTAGTTGTTTCAACGCTGTCGCACGCTATCGCTTTGGCATCCGAACTCGGCAATGAACTCTACGTCGCGGGCGGAGCTGAGATATACACTCTGGCACTACCTCACGCCCACGGCGTGTTTCTATCTGAGGTACATCAAACCTTCGAGGGTGACGCCTTCTTCCCAATGCTCAACGAAACAGAATTCGAGCTTGTCTCAACCGAAACCATTCAAGCTGTAATTCCGTACACCCACTCCGTTTATGCGCGTCGAAACGGCTAACCATTCCGTCAACGGGACGCCAAAATGCTGCGCATTTTGGTTCCCTCCGC