Homologs in group_2750

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07460 FBDBKF_07460 100.0 Morganella morganii S1 cysG2 Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain)
EHELCC_17130 EHELCC_17130 100.0 Morganella morganii S2 cysG2 Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain)
LHKJJB_09115 LHKJJB_09115 100.0 Morganella morganii S3 cysG2 Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain)
HKOGLL_08665 HKOGLL_08665 100.0 Morganella morganii S5 cysG2 Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain)
F4V73_RS13655 F4V73_RS13655 81.2 Morganella psychrotolerans - bifunctional precorrin-2 dehydrogenase/sirohydrochlorin ferrochelatase

Distribution of the homologs in the orthogroup group_2750

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2750

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4TY38 7.55e-47 163 41 2 217 3 cysG Siroheme synthase Salmonella schwarzengrund (strain CVM19633)
A7MKK9 8.3e-47 163 41 2 217 3 cysG2 Siroheme synthase 2 Cronobacter sakazakii (strain ATCC BAA-894)
B5YTS6 1.85e-46 162 41 2 217 3 cysG Siroheme synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8Z201 2.73e-46 162 41 2 217 3 cysG Siroheme synthase Salmonella typhi
P25924 6.34e-46 160 41 2 217 1 cysG Siroheme synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0Q0F3 6.54e-46 160 41 2 217 3 cysG Siroheme synthase Salmonella paratyphi C (strain RKS4594)
A9MT45 6.54e-46 160 41 2 217 3 cysG Siroheme synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5R2C7 6.54e-46 160 41 2 217 3 cysG Siroheme synthase Salmonella enteritidis PT4 (strain P125109)
Q57IZ5 6.54e-46 160 41 2 217 3 cysG Siroheme synthase Salmonella choleraesuis (strain SC-B67)
B4SVI1 6.82e-46 160 41 2 217 3 cysG Siroheme synthase Salmonella newport (strain SL254)
B5F8J0 7.08e-46 160 41 2 217 3 cysG Siroheme synthase Salmonella agona (strain SL483)
B5BH22 8.78e-46 160 41 2 217 3 cysG Siroheme synthase Salmonella paratyphi A (strain AKU_12601)
Q5PLV8 8.78e-46 160 41 2 217 3 cysG Siroheme synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TKQ4 1.02e-45 160 40 2 217 3 cysG Siroheme synthase Salmonella heidelberg (strain SL476)
B5R7N6 1.03e-45 160 40 2 217 3 cysG Siroheme synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q3YWQ3 1.58e-45 159 41 2 217 3 cysG Siroheme synthase Shigella sonnei (strain Ss046)
Q83JB3 1.58e-45 159 41 2 217 3 cysG Siroheme synthase Shigella flexneri
Q0SZU8 1.58e-45 159 41 2 217 3 cysG Siroheme synthase Shigella flexneri serotype 5b (strain 8401)
A8AQS4 1.67e-45 159 40 2 217 3 cysG Siroheme synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B6I2S7 2.13e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli (strain SE11)
B7M1S1 2.13e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli O8 (strain IAI1)
A7ZSP4 2.13e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
B5FJQ1 2.34e-45 159 40 2 217 3 cysG Siroheme synthase Salmonella dublin (strain CT_02021853)
Q32AZ8 2.44e-45 159 41 2 217 3 cysG Siroheme synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q8FCW8 2.57e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7N1F1 2.57e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli O81 (strain ED1a)
B7UK79 2.57e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1LHG9 2.74e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli (strain SMS-3-5 / SECEC)
P0AEA8 2.74e-45 159 41 2 217 1 cysG Siroheme synthase Escherichia coli (strain K12)
B1IP96 2.74e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5H5 2.74e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli O9:H4 (strain HS)
B1X716 2.74e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli (strain K12 / DH10B)
C4ZUM4 2.74e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli (strain K12 / MC4100 / BW2952)
P0AEA9 2.74e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli O157:H7
B7L4P2 2.74e-45 159 41 2 217 3 cysG Siroheme synthase Escherichia coli (strain 55989 / EAEC)
A6TF07 3.6e-45 159 41 2 217 3 cysG2 Siroheme synthase 2 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q0TC92 4.88e-45 158 40 2 217 3 cysG Siroheme synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q1R5R3 5.09e-45 158 40 2 217 3 cysG Siroheme synthase Escherichia coli (strain UTI89 / UPEC)
A1AGQ2 5.09e-45 158 40 2 217 3 cysG Siroheme synthase Escherichia coli O1:K1 / APEC
B7MCY5 5.09e-45 158 40 2 217 3 cysG Siroheme synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7NMD7 5.48e-45 158 40 2 217 3 cysG Siroheme synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7LS75 5.65e-45 158 40 2 217 3 cysG Siroheme synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q31VS0 6.69e-45 158 40 2 217 3 cysG Siroheme synthase Shigella boydii serotype 4 (strain Sb227)
B2U3H4 6.69e-45 158 40 2 217 3 cysG Siroheme synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A9MME5 7.67e-45 158 41 2 217 3 cysG Siroheme synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WFH1 1.74e-44 157 41 3 215 3 cysG Siroheme synthase Enterobacter sp. (strain 638)
B7NDX8 2.31e-44 156 40 2 217 3 cysG Siroheme synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q6CZS0 6.25e-42 150 39 2 213 3 cysG2 Siroheme synthase 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C5BGP8 3.55e-39 143 41 2 194 3 cysG Siroheme synthase Edwardsiella ictaluri (strain 93-146)
A1JSB7 4.27e-37 137 39 2 209 3 cysG2 Siroheme synthase 2 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKQ1 8.23e-37 137 38 2 213 3 cysG2 Siroheme synthase 2 Serratia proteamaculans (strain 568)
A0KLD7 1.71e-36 135 42 3 185 3 cysG1 Siroheme synthase 1 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q664M6 3.83e-35 132 40 2 197 3 cysG2 Siroheme synthase 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FNS9 3.83e-35 132 40 2 197 3 cysG2 Siroheme synthase 2 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A0KQJ4 1.4e-34 130 37 3 216 3 cysG3 Siroheme synthase 3 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4TGU8 3.45e-34 130 39 2 197 3 cysG1 Siroheme synthase 1 Yersinia pestis (strain Pestoides F)
A4SHL4 5.37e-34 129 37 2 213 3 cysG1 Siroheme synthase 1 Aeromonas salmonicida (strain A449)
Q74Y23 2.89e-33 127 39 3 197 3 cysG Siroheme synthase Yersinia pestis
Q1C2P9 2.89e-33 127 39 3 197 3 cysG Siroheme synthase Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CCP6 2.89e-33 127 39 3 197 3 cysG2 Siroheme synthase 2 Yersinia pestis bv. Antiqua (strain Nepal516)
B7UW11 2.71e-31 122 37 3 211 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain LESB58)
Q9I0M7 2.76e-31 122 37 3 211 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6V4H6 4.07e-31 121 37 3 211 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain PA7)
Q02NA3 7.89e-31 120 37 3 211 3 cysG Siroheme synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q3JCS0 1.33e-30 120 36 2 193 3 cysG Siroheme synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q7NZV7 4.19e-29 116 39 2 181 3 cysG Siroheme synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B0BTC2 2.11e-28 114 35 2 192 3 cysG Siroheme synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q1H3L5 2.41e-28 114 36 2 198 3 cysG Siroheme synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2KWB0 2.97e-28 113 35 3 208 3 cysG Siroheme synthase Bordetella avium (strain 197N)
A1SRP9 3.02e-28 114 33 2 189 3 cysG Siroheme synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A4VLU6 4.17e-28 113 37 3 208 3 cysG Siroheme synthase Stutzerimonas stutzeri (strain A1501)
B3GZA0 1.09e-27 112 35 2 192 3 cysG Siroheme synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q15YU1 1.15e-27 112 32 3 208 3 cysG Siroheme synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A7MJ67 1.79e-27 111 35 2 184 3 cysG1 Siroheme synthase 1 Cronobacter sakazakii (strain ATCC BAA-894)
Q1IBC9 1.89e-27 111 37 4 200 3 cysG Siroheme synthase Pseudomonas entomophila (strain L48)
Q7WB57 2.3e-27 111 38 2 180 3 cysG Siroheme synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WMM4 2.3e-27 111 38 2 180 3 cysG Siroheme synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZ77 2.54e-27 111 38 2 180 3 cysG Siroheme synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q65T49 7.74e-27 110 32 2 185 3 cysG Siroheme synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1AVU5 1.24e-26 109 30 2 203 3 cysG Siroheme synthase Ruthia magnifica subsp. Calyptogena magnifica
A5CXE4 2.25e-26 108 30 2 199 3 cysG Siroheme synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A0KP37 2.32e-26 108 36 3 213 3 cysG2 Siroheme synthase 2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
P57500 6.82e-26 107 29 2 195 3 cysG Siroheme synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q6LM67 1.58e-25 106 34 2 180 3 cysG Siroheme synthase Photobacterium profundum (strain SS9)
Q5NRM4 1.65e-25 106 33 2 181 3 cysG Siroheme synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A4SRH0 3.73e-25 105 34 3 213 3 cysG2 Siroheme synthase 2 Aeromonas salmonicida (strain A449)
C1DKY7 5.69e-25 104 35 3 198 3 cysG Siroheme synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4K9V8 6.29e-25 104 36 5 205 3 cysG Siroheme synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q7N8L2 6.29e-25 104 33 2 181 3 cysG Siroheme synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C3JY53 8.23e-25 104 36 4 210 3 cysG Siroheme synthase Pseudomonas fluorescens (strain SBW25)
A6TD45 8.79e-25 104 32 2 181 3 cysG1 Siroheme synthase 1 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q0AHC1 1.96e-24 103 32 2 205 3 cysG Siroheme synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A4XUX3 2.22e-24 103 34 3 192 3 cysG Siroheme synthase Pseudomonas mendocina (strain ymp)
Q820Q4 3.05e-24 102 31 4 212 3 cysG Siroheme synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q3SG32 3.62e-24 102 36 4 199 3 cysG Siroheme synthase Thiobacillus denitrificans (strain ATCC 25259)
Q3ILQ9 4.95e-24 102 32 3 217 3 cysG Siroheme synthase Pseudoalteromonas translucida (strain TAC 125)
A1WWP8 5.21e-24 102 33 2 209 3 cysG1 Siroheme synthase 1 Halorhodospira halophila (strain DSM 244 / SL1)
Q6D1A4 5.62e-24 102 34 2 185 3 cysG1 Siroheme synthase 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q87ZT0 6.37e-24 101 36 3 185 3 cysG Siroheme synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KA85 6.83e-24 101 36 5 205 3 cysG Siroheme synthase Pseudomonas fluorescens (strain Pf0-1)
Q4ZRL6 1.08e-23 101 36 4 185 3 cysG Siroheme synthase Pseudomonas syringae pv. syringae (strain B728a)
Q48H75 1.25e-23 100 36 4 185 3 cysG Siroheme synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A8G9Y3 1.3e-23 100 34 2 180 3 cysG1 Siroheme synthase 1 Serratia proteamaculans (strain 568)
A9LZ77 1.48e-23 100 34 2 185 3 cysG Siroheme synthase Neisseria meningitidis serogroup C (strain 053442)
C4LAG5 1.67e-23 100 36 4 196 3 cysG Siroheme synthase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B8GUD3 3.64e-23 99 35 6 196 3 cysG Siroheme synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A9HZV6 7.23e-23 99 40 2 144 3 cysG Siroheme synthase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q2Y6L7 1.21e-22 98 32 3 204 3 cysG Siroheme synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q7VQG9 1.43e-22 97 31 3 193 3 cysG Siroheme synthase Blochmanniella floridana
A1WYD5 2.89e-22 97 32 2 200 3 cysG2 Siroheme synthase 2 Halorhodospira halophila (strain DSM 244 / SL1)
Q21K21 3.66e-22 96 32 2 189 3 cysG Siroheme synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q606C9 3.77e-22 97 38 2 186 3 cysG Siroheme synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5WEG6 5.35e-22 96 29 3 222 3 cysG Siroheme synthase Psychrobacter sp. (strain PRwf-1)
Q2NVN0 1.17e-21 95 34 2 182 3 cysG Siroheme synthase Sodalis glossinidius (strain morsitans)
Q6F8G6 1.58e-21 95 29 5 219 3 cysG Siroheme synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1QAX7 3.62e-21 94 31 3 193 3 cysG Siroheme synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q0VQ05 6.43e-21 93 32 2 195 3 cysG Siroheme synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1KU10 6.61e-21 93 35 2 185 3 cysG Siroheme synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q1LTP4 6.71e-21 93 29 2 181 3 cysG Siroheme synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q31GG8 6.82e-21 93 30 2 189 3 cysG Siroheme synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q4FSU1 7.55e-21 93 29 2 201 3 cysG Siroheme synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
P57001 8.36e-21 93 35 2 185 3 cysG Siroheme synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P95370 1.03e-20 92 35 2 185 3 cysG Siroheme synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q0A812 2.13e-20 92 33 5 204 3 cysG Siroheme synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1JJS8 2.3e-20 91 34 2 181 3 cysG1 Siroheme synthase 1 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A6VPZ6 1.45e-19 89 32 2 185 3 cysG Siroheme synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A7FLY4 2.22e-19 89 32 3 184 3 cysG1 Siroheme synthase 1 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66EC9 2.36e-19 89 32 3 184 3 cysG1 Siroheme synthase 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPZ1 2.47e-19 89 32 3 184 3 cysG2 Siroheme synthase 2 Yersinia pestis (strain Pestoides F)
Q1CLS2 2.47e-19 89 32 3 184 3 cysG1 Siroheme synthase 1 Yersinia pestis bv. Antiqua (strain Nepal516)
B1JBD9 7.43e-19 87 36 2 195 3 cysG Siroheme synthase Pseudomonas putida (strain W619)
A5W1H7 1.18e-18 87 36 2 195 3 cysG Siroheme synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88FT3 1.5e-18 86 36 2 195 3 cysG Siroheme synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9PF46 1.61e-18 86 30 4 191 3 cysG Siroheme synthase Xylella fastidiosa (strain 9a5c)
Q87AI5 3.78e-18 85 30 3 179 3 cysG Siroheme synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I985 3.78e-18 85 30 3 179 3 cysG Siroheme synthase Xylella fastidiosa (strain M23)
Q2SJB7 4.61e-18 85 34 4 192 3 cysG Siroheme synthase Hahella chejuensis (strain KCTC 2396)
Q493N1 5.45e-18 85 27 4 202 3 cysG Siroheme synthase Blochmanniella pennsylvanica (strain BPEN)
B0U4X0 6.15e-18 84 30 3 179 3 cysG Siroheme synthase Xylella fastidiosa (strain M12)
Q5FP95 8.53e-16 78 32 2 149 3 cysG Siroheme synthase Gluconobacter oxydans (strain 621H)
A9H259 2.96e-13 71 34 3 185 3 cysG Siroheme synthase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q59292 3.7e-13 71 32 1 121 3 hemA Probable multifunctional siroheme biosynthesis protein HemA Ruminiclostridium josui
Q57605 2.04e-11 64 23 5 196 3 MJ0140 Putative precorrin-2 dehydrogenase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q46CH4 2.86e-08 55 24 6 190 1 Mbar_A1461 Precorrin-2 dehydrogenase Methanosarcina barkeri (strain Fusaro / DSM 804)
O34813 3.91e-08 54 23 4 152 1 sirC Precorrin-2 dehydrogenase Bacillus subtilis (strain 168)
P61818 1.11e-05 48 24 3 139 1 sirC Precorrin-2 dehydrogenase Priestia megaterium

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18510
Feature type CDS
Gene cysG2
Product Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain)
Location 31687 - 32343 (strand: 1)
Length 657 (nucleotides) / 218 (amino acids)
In genomic island -

Contig

Accession ZDB_541
Length 32595 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2750
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF13241 Putative NAD(P)-binding

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1648 Coenzyme transport and metabolism (H) H Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain)

Kegg Ortholog Annotation(s)

Protein Sequence

MLRYPLFCDLQGKTCLVVGGGEVAAHKCRTLLQAGAHVTVIARWFHGDLTALAGNPHLTLTEADFDAALWPQGCWLAFAATDSPEVNQQVLEQANARHCFCNVTDAPEGASFISPATIDVPPVQIALTCGGNPVYTQFLKHRVMQAIPADAPVKLRAAARLREQVKATNASRDAKRLFWQKFFTDTALEQLLPLEDEELLTDYLNYLLAQFTEEHGIR

Flanking regions ( +/- flanking 50bp)

AGGATATGATTCAGACAACTGATTCTGACGCTGTCCGCAAAGGAGACACTATGCTGCGTTATCCGCTGTTTTGTGATTTACAGGGAAAGACCTGTCTGGTCGTGGGGGGCGGGGAAGTTGCCGCCCATAAATGCCGGACACTGTTACAGGCCGGGGCGCATGTCACCGTCATTGCCCGCTGGTTTCACGGAGATCTCACCGCACTGGCGGGAAATCCGCATCTTACGCTGACAGAAGCGGACTTTGATGCTGCACTGTGGCCGCAGGGCTGCTGGCTGGCCTTTGCCGCGACGGATTCACCCGAGGTGAATCAGCAGGTGCTGGAACAGGCCAATGCCCGCCATTGTTTCTGTAACGTCACTGACGCGCCGGAAGGTGCCTCATTTATCTCCCCGGCCACCATTGATGTCCCGCCGGTTCAGATTGCGCTGACCTGCGGCGGAAACCCGGTCTATACACAGTTTCTGAAACACCGTGTTATGCAGGCGATTCCGGCGGATGCCCCGGTGAAACTGCGTGCCGCCGCACGGCTGCGCGAGCAGGTAAAAGCCACTAATGCTTCCCGCGATGCCAAACGGCTGTTCTGGCAGAAATTTTTTACCGACACCGCTCTGGAGCAACTCCTGCCGCTGGAAGACGAGGAACTGCTGACTGACTACCTTAATTACCTGCTGGCTCAGTTTACCGAAGAGCACGGAATCCGCTGAAAAAATAAAACCCCGGCACCGTAATAGCGGTTCCGGGGTAATTATGTGAG