Homologs in group_2224

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17010 FBDBKF_17010 100.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_16580 EHELCC_16580 100.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_16680 LHKJJB_16680 100.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_17645 HKOGLL_17645 100.0 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS18470 F4V73_RS18470 97.3 Morganella psychrotolerans - XRE family transcriptional regulator
PMI_RS17505 PMI_RS17505 66.9 Proteus mirabilis HI4320 - XRE family transcriptional regulator

Distribution of the homologs in the orthogroup group_2224

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2224

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77626 1.21e-11 63 29 4 156 1 sutR HTH-type transcriptional regulator SutR Escherichia coli (strain K12)
O32237 7.91e-08 52 30 3 108 4 rghRB Uncharacterized HTH-type transcriptional regulator RghRB Bacillus subtilis (strain 168)
P71049 2.76e-06 48 35 1 70 4 slrR HTH-type transcriptional regulator SlrR Bacillus subtilis (strain 168)
O32236 7.55e-05 44 35 1 56 1 rghR HTH-type transcriptional repressor RghR Bacillus subtilis (strain 168)
C1CYP4 0.000133 43 35 1 70 1 ddrOC HTH-type transcriptional regulator DdrOC Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
P06153 0.00085 41 36 0 52 1 None Immunity repressor protein Bacillus phage phi105

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16790
Feature type CDS
Gene hipB
Product Transcriptional regulator, contains XRE-family HTH domain
Location 36057 - 36614 (strand: -1)
Length 558 (nucleotides) / 185 (amino acids)

Contig

Accession ZDB_534
Length 68509 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2224
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K23779 XRE family transcriptional regulator, regulator of sulfur utilization - -

Protein Sequence

MLKTSAHIGQKVKLLRQARNLSLNDLSKLSGISKAALSKLESGDSNPRIDTLEAIAVALRFPLGDLFTASNEGYPRYEKNKVFKGEYAEDFKFRVGMGNISEIWHLKMIRGAIINSPAHSTGTHEHILIHQGTLMMRFNEDQTVLLEPGDFYAFSCDIPHSYICMEGELSGTLIMSYSHIGQTSP

Flanking regions ( +/- flanking 50bp)

TGCAATACTAACAGGGTTTCCCTGCAAATTTCATTGGTATCAATTACATTATGCTTAAAACCAGTGCCCACATCGGCCAGAAAGTCAAACTGCTGCGTCAGGCGCGTAACCTGTCGCTCAATGATCTTTCAAAACTCTCCGGCATCTCGAAAGCCGCGCTGTCCAAACTGGAATCCGGTGATTCCAATCCGCGTATCGATACACTGGAGGCCATTGCCGTCGCACTGCGTTTTCCGCTGGGGGATCTGTTTACCGCCAGTAATGAAGGTTATCCCCGTTACGAAAAAAATAAAGTCTTTAAAGGGGAATATGCGGAAGATTTTAAATTCCGTGTCGGCATGGGGAATATTTCGGAGATCTGGCACCTGAAGATGATCCGCGGTGCGATTATTAACAGCCCCGCACACAGCACCGGCACCCATGAGCATATTCTTATCCATCAGGGTACGCTGATGATGCGATTTAATGAAGATCAGACTGTGCTGCTGGAACCGGGGGATTTCTATGCGTTCTCCTGTGATATTCCCCACTCTTATATCTGCATGGAAGGCGAGCTGAGCGGCACGCTGATTATGTCCTATTCCCATATCGGCCAGACATCGCCGTAACCACAGACAAAAAACCGGGCTTATCTGCCCGGTTTCATCATTCTACTGAA