Homologs in group_2003

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15060 FBDBKF_15060 100.0 Morganella morganii S1 gshB glutathione synthase
EHELCC_11185 EHELCC_11185 100.0 Morganella morganii S2 gshB glutathione synthase
LHKJJB_11390 LHKJJB_11390 100.0 Morganella morganii S3 gshB glutathione synthase
HKOGLL_10000 HKOGLL_10000 100.0 Morganella morganii S5 gshB glutathione synthase
F4V73_RS12390 F4V73_RS12390 96.8 Morganella psychrotolerans gshB glutathione synthase
PMI_RS01625 PMI_RS01625 85.8 Proteus mirabilis HI4320 gshB glutathione synthase

Distribution of the homologs in the orthogroup group_2003

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2003

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7M7H8 0.0 565 84 0 316 3 gshB Glutathione synthetase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P58582 0.0 534 79 0 315 3 gshB Glutathione synthetase Yersinia pestis
P58580 0.0 520 78 1 316 3 gshB Glutathione synthetase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P58581 0.0 517 78 1 316 3 gshB Glutathione synthetase Salmonella typhi
Q9KUP7 0.0 516 77 1 314 3 gshB Glutathione synthetase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B7UHZ4 0.0 516 77 1 316 1 gshB Glutathione synthetase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8FE30 0.0 514 77 1 316 3 gshB Glutathione synthetase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A0A482PU20 0.0 513 77 1 316 1 gshB Glutathione synthetase Citrobacter rodentium
Q7MHK1 0.0 513 77 1 314 3 gshB Glutathione synthetase Vibrio vulnificus (strain YJ016)
Q8DCA9 0.0 512 76 1 314 3 gshB Glutathione synthetase Vibrio vulnificus (strain CMCP6)
Q83Q91 0.0 512 77 1 316 3 gshB Glutathione synthetase Shigella flexneri
P04425 0.0 512 77 1 316 1 gshB Glutathione synthetase Escherichia coli (strain K12)
P58578 0.0 511 77 1 316 3 gshB Glutathione synthetase Escherichia coli O157:H7
Q87LK1 0.0 511 76 1 314 3 gshB Glutathione synthetase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8EIK8 4.97e-165 464 69 1 316 3 gshB Glutathione synthetase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P57612 1.23e-153 436 62 1 313 3 gshB Glutathione synthetase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q87VA4 1.74e-150 427 67 1 314 3 gshB Glutathione synthetase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88D35 4.05e-145 414 65 1 313 3 gshB Glutathione synthetase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8K931 2.17e-142 407 57 1 315 3 gshB Glutathione synthetase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9I697 2.91e-141 404 62 1 314 3 gshB Glutathione synthetase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8D335 5.34e-126 365 53 2 315 3 gshB Glutathione synthetase Wigglesworthia glossinidia brevipalpis
P59495 4.77e-123 358 51 2 316 3 gshB Glutathione synthetase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8P6P1 1.28e-120 352 57 1 306 3 gshB Glutathione synthetase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PHZ5 3.54e-117 343 56 1 306 3 gshB Glutathione synthetase Xanthomonas axonopodis pv. citri (strain 306)
Q83AL0 1.33e-113 334 51 1 314 3 gshB Glutathione synthetase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q82V16 3.55e-111 328 52 4 320 3 gshB Glutathione synthetase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P58579 4.15e-111 328 51 1 311 3 gshB Glutathione synthetase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q87D42 4.79e-110 325 52 1 306 3 gshB Glutathione synthetase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PC29 3.27e-109 323 52 1 306 3 gshB Glutathione synthetase Xylella fastidiosa (strain 9a5c)
Q7NQ65 4.14e-107 317 50 1 312 3 gshB Glutathione synthetase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7W910 4.5e-95 287 47 3 312 3 gshB Glutathione synthetase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKF5 4.5e-95 287 47 3 312 3 gshB Glutathione synthetase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VY62 1.9e-93 283 47 3 312 3 gshB Glutathione synthetase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q9JTJ6 3.73e-89 272 45 3 313 3 gshB Glutathione synthetase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JYJ3 2.42e-87 267 44 1 297 3 gshB Glutathione synthetase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q92SN3 1.4e-80 250 41 3 313 3 gshB Glutathione synthetase Rhizobium meliloti (strain 1021)
Q98DE8 2.65e-76 239 39 3 312 3 gshB Glutathione synthetase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8FXW6 5.23e-75 235 39 3 312 3 gshb Glutathione synthetase Brucella suis biovar 1 (strain 1330)
Q9ABS9 8.25e-75 235 41 3 294 3 gshB Glutathione synthetase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8YE82 1.33e-74 234 39 3 312 3 gshB Glutathione synthetase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8UII5 2.67e-74 234 39 3 311 3 gshB Glutathione synthetase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q89WL0 1.32e-72 229 39 4 316 3 gshB Glutathione synthetase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q7TVB0 1.21e-71 227 42 2 288 3 gshB Glutathione synthetase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q8DKF1 6.07e-71 225 38 2 302 3 gshB Glutathione synthetase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P61396 6.49e-71 225 38 4 313 3 gshB Glutathione synthetase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7U3W8 2.44e-69 221 41 4 292 3 gshB Glutathione synthetase Parasynechococcus marenigrum (strain WH8102)
O32463 1.25e-66 214 38 2 302 3 gshB Glutathione synthetase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7NF44 1.34e-66 214 40 2 298 3 gshB Glutathione synthetase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P73493 3.64e-66 213 36 2 302 3 gshB Glutathione synthetase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7TUG9 4.01e-64 207 39 2 293 3 gshB Glutathione synthetase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q7TUK9 3.25e-62 202 40 3 291 3 gshB Glutathione synthetase Prochlorococcus marinus (strain MIT 9313)
P45480 5.83e-57 189 34 5 307 3 gshB Glutathione synthetase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P35667 9.54e-45 157 31 5 293 3 gshB Glutathione synthetase Anaplasma centrale
Q7MCS5 5.48e-08 57 26 9 232 3 rimK Probable alpha-L-glutamate ligase Vibrio vulnificus (strain YJ016)
Q8D5R2 5.48e-08 57 26 9 232 3 rimK Probable alpha-L-glutamate ligase Vibrio vulnificus (strain CMCP6)
Q87JS5 1.65e-07 55 27 9 232 3 rimK Probable alpha-L-glutamate ligase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0TTR5 3.21e-07 55 24 15 319 3 rimK Probable alpha-L-glutamate ligase Shewanella halifaxensis (strain HAW-EB4)
Q58037 4.55e-07 53 27 8 186 1 mptN Tetrahydromethanopterin:alpha-L-glutamate ligase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
C5BQP1 2.04e-06 52 26 9 226 3 rimK Probable alpha-L-glutamate ligase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q8TKX5 1.76e-05 49 23 12 290 3 mptN Tetrahydromethanopterin:alpha-L-glutamate ligase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8Q0M5 2.28e-05 48 23 12 292 3 mptN Tetrahydromethanopterin:alpha-L-glutamate ligase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A3QJ82 2.49e-05 48 25 9 227 3 rimK Probable alpha-L-glutamate ligase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q9CMJ8 5.55e-05 47 31 5 132 3 rimK Probable alpha-L-glutamate ligase Pasteurella multocida (strain Pm70)
Q15S48 0.000596 44 26 10 230 3 rimK1 Probable alpha-L-glutamate ligase 1 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q21J37 0.000668 44 24 9 225 3 rimK Probable alpha-L-glutamate ligase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B5FBB1 0.000844 44 25 10 233 3 rimK Probable alpha-L-glutamate ligase Aliivibrio fischeri (strain MJ11)
Q5E743 0.001 43 25 10 233 3 rimK Probable alpha-L-glutamate ligase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q4J8E7 0.001 43 27 10 210 1 argX Glutamate--LysW ligase ArgX Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_11530
Feature type CDS
Gene gshB
Product glutathione synthase
Location 62583 - 63533 (strand: 1)
Length 951 (nucleotides) / 316 (amino acids)

Contig

Accession ZDB_526
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2003
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02951 Prokaryotic glutathione synthetase, N-terminal domain
PF02955 Prokaryotic glutathione synthetase, ATP-grasp domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0189 Amino acid transport and metabolism (E)
Coenzyme transport and metabolism (H)
Translation, ribosomal structure and biogenesis (J)
Secondary metabolites biosynthesis, transport and catabolism (Q)		 EHJQ Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily

Kegg Ortholog Annotation(s)

Protein Sequence

MIKLGIVMDPIDSIKIKKDTSFAMLLEAQRRGYEIHYMEMNDLYLHQGVARARTRTLTVKEDPAGWYQFGSEQDIALGTLNVILMRKDPPFDTEFIYATYILERAESAGSLIVNKPQSLRDCNEKLFTAWFADLTPDTLVTRSAQRLREFHQKHGDVIFKPLDGMGGASIFRLKQDDPNVGVIIETLTNHGHTFCMAQNFLPAIKDGDKRILVVDGEPVPYCLARIPAKGETRGNLAAGGHGEVRPLSESDWAIARSVAPVLKEKGLIFVGLDVIGDRLTEINVTSPTCAREIEAAQPDVSVTGMLMDAIEKRLSR

Flanking regions ( +/- flanking 50bp)

CAATCACCGCATTGCAGGTGCGTTTCGGCGATCTGGGTTAAGGAGAAAAAATGATCAAGCTCGGTATTGTGATGGATCCTATCGATTCCATCAAAATCAAGAAAGACACCAGTTTCGCGATGCTGCTCGAAGCACAGCGCCGTGGTTATGAAATCCATTATATGGAGATGAATGACCTTTATCTGCATCAGGGCGTTGCCCGTGCCCGTACCCGTACTCTGACGGTGAAAGAAGACCCGGCCGGCTGGTATCAGTTCGGCAGTGAGCAGGATATCGCGCTGGGCACACTGAATGTCATTCTGATGCGCAAAGATCCGCCGTTTGATACTGAATTCATTTACGCCACCTATATCCTGGAGCGCGCGGAAAGTGCCGGCTCCCTGATCGTCAATAAACCGCAGAGCCTGCGCGACTGTAACGAAAAACTGTTCACCGCCTGGTTTGCCGATCTGACCCCGGACACCCTGGTCACCCGCAGTGCACAACGTCTGCGTGAATTCCACCAAAAACACGGTGATGTGATTTTCAAACCGCTCGACGGCATGGGCGGTGCATCTATTTTCCGTCTGAAACAGGATGATCCGAACGTCGGCGTGATTATCGAAACCCTGACAAATCACGGTCATACTTTCTGCATGGCGCAAAACTTCCTGCCTGCCATCAAAGACGGTGACAAACGTATCCTGGTGGTGGACGGCGAGCCGGTTCCTTACTGCCTGGCGCGCATTCCGGCCAAAGGCGAAACGCGCGGTAACCTCGCTGCCGGTGGTCACGGTGAAGTGCGTCCGCTGAGTGAGAGCGATTGGGCCATTGCCCGCAGCGTGGCACCGGTCCTCAAAGAAAAAGGTCTGATTTTTGTCGGCCTCGATGTAATCGGCGACCGCCTGACTGAAATCAACGTAACCAGCCCGACCTGTGCCCGCGAAATTGAAGCCGCACAACCGGATGTTTCTGTCACCGGCATGCTGATGGATGCCATTGAAAAACGTCTCAGCCGGTAACAGCCGGCGCTGTGTCCGTACATTCACACCCGCAGGCTGTTTTTTCCGGT