Homologs in group_2041

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15060 FBDBKF_15060 96.8 Morganella morganii S1 gshB glutathione synthase
EHELCC_11185 EHELCC_11185 96.8 Morganella morganii S2 gshB glutathione synthase
NLDBIP_11530 NLDBIP_11530 96.8 Morganella morganii S4 gshB glutathione synthase
LHKJJB_11390 LHKJJB_11390 96.8 Morganella morganii S3 gshB glutathione synthase
HKOGLL_10000 HKOGLL_10000 96.8 Morganella morganii S5 gshB glutathione synthase
PMI_RS01625 PMI_RS01625 85.4 Proteus mirabilis HI4320 gshB glutathione synthase

Distribution of the homologs in the orthogroup group_2041

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2041

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7M7H8 0.0 553 82 0 316 3 gshB Glutathione synthetase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P58582 0.0 527 78 0 315 3 gshB Glutathione synthetase Yersinia pestis
P58580 0.0 515 77 1 316 3 gshB Glutathione synthetase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B7UHZ4 0.0 512 78 1 314 1 gshB Glutathione synthetase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P58581 0.0 512 77 1 316 3 gshB Glutathione synthetase Salmonella typhi
Q8FE30 0.0 511 77 1 314 3 gshB Glutathione synthetase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A0A482PU20 0.0 508 76 1 316 1 gshB Glutathione synthetase Citrobacter rodentium
Q9KUP7 0.0 508 76 1 314 3 gshB Glutathione synthetase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q83Q91 0.0 508 77 1 314 3 gshB Glutathione synthetase Shigella flexneri
P04425 0.0 508 77 1 314 1 gshB Glutathione synthetase Escherichia coli (strain K12)
P58578 0.0 508 77 1 314 3 gshB Glutathione synthetase Escherichia coli O157:H7
Q7MHK1 0.0 507 75 1 314 3 gshB Glutathione synthetase Vibrio vulnificus (strain YJ016)
Q8DCA9 0.0 507 75 1 314 3 gshB Glutathione synthetase Vibrio vulnificus (strain CMCP6)
Q87LK1 0.0 506 75 1 314 3 gshB Glutathione synthetase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8EIK8 6.28e-163 459 68 1 316 3 gshB Glutathione synthetase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P57612 3.51e-150 427 61 1 313 3 gshB Glutathione synthetase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q87VA4 2.12e-148 422 66 1 313 3 gshB Glutathione synthetase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88D35 2.88e-145 414 65 1 313 3 gshB Glutathione synthetase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8K931 2.33e-141 404 57 1 315 3 gshB Glutathione synthetase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9I697 1.79e-140 402 62 1 314 3 gshB Glutathione synthetase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8D335 1.87e-126 367 53 2 315 3 gshB Glutathione synthetase Wigglesworthia glossinidia brevipalpis
P59495 2.11e-121 354 51 2 316 3 gshB Glutathione synthetase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8P6P1 9.35e-118 344 56 1 306 3 gshB Glutathione synthetase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PHZ5 4.27e-114 335 54 1 306 3 gshB Glutathione synthetase Xanthomonas axonopodis pv. citri (strain 306)
Q83AL0 1.45e-112 332 50 1 312 3 gshB Glutathione synthetase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q82V16 6.97e-110 325 51 4 320 3 gshB Glutathione synthetase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P58579 2.32e-109 323 49 1 315 3 gshB Glutathione synthetase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q87D42 2.74e-108 320 51 1 306 3 gshB Glutathione synthetase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PC29 3.59e-107 317 51 1 306 3 gshB Glutathione synthetase Xylella fastidiosa (strain 9a5c)
Q7NQ65 2.33e-104 310 49 1 312 3 gshB Glutathione synthetase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7W910 8.31e-94 284 48 2 293 3 gshB Glutathione synthetase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKF5 8.31e-94 284 48 2 293 3 gshB Glutathione synthetase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VY62 2.22e-92 280 48 2 293 3 gshB Glutathione synthetase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q9JTJ6 5.53e-87 266 44 3 313 3 gshB Glutathione synthetase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JYJ3 4.3e-86 264 44 1 297 3 gshB Glutathione synthetase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q92SN3 7.38e-80 248 41 3 313 3 gshB Glutathione synthetase Rhizobium meliloti (strain 1021)
Q98DE8 7.89e-77 240 39 3 312 3 gshB Glutathione synthetase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9ABS9 4.83e-76 238 41 3 294 3 gshB Glutathione synthetase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8FXW6 1.06e-75 237 40 3 312 3 gshb Glutathione synthetase Brucella suis biovar 1 (strain 1330)
Q8YE82 2.92e-75 236 40 3 312 3 gshB Glutathione synthetase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8UII5 6.02e-74 233 39 3 311 3 gshB Glutathione synthetase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q89WL0 4.2e-71 226 39 4 313 3 gshB Glutathione synthetase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q7TVB0 6.43e-71 225 41 2 288 3 gshB Glutathione synthetase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
P61396 1.61e-70 224 38 4 313 3 gshB Glutathione synthetase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8DKF1 1.73e-70 224 38 2 302 3 gshB Glutathione synthetase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q7U3W8 4.05e-68 218 41 4 291 3 gshB Glutathione synthetase Parasynechococcus marenigrum (strain WH8102)
O32463 2.4e-67 216 37 3 319 3 gshB Glutathione synthetase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7NF44 4.28e-67 216 40 2 298 3 gshB Glutathione synthetase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P73493 8.62e-66 212 36 2 302 3 gshB Glutathione synthetase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7TUG9 1.61e-63 206 39 2 293 3 gshB Glutathione synthetase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q7TUK9 3.08e-62 202 40 3 291 3 gshB Glutathione synthetase Prochlorococcus marinus (strain MIT 9313)
P45480 1.18e-57 191 34 3 304 3 gshB Glutathione synthetase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P35667 4.65e-44 155 30 5 297 3 gshB Glutathione synthetase Anaplasma centrale
B0TTR5 1.64e-07 55 24 14 302 3 rimK Probable alpha-L-glutamate ligase Shewanella halifaxensis (strain HAW-EB4)
C5BQP1 2.89e-07 54 26 9 226 3 rimK Probable alpha-L-glutamate ligase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q7MCS5 3.56e-07 54 25 9 232 3 rimK Probable alpha-L-glutamate ligase Vibrio vulnificus (strain YJ016)
Q8D5R2 3.56e-07 54 25 9 232 3 rimK Probable alpha-L-glutamate ligase Vibrio vulnificus (strain CMCP6)
Q87JS5 1.05e-06 53 26 9 226 3 rimK Probable alpha-L-glutamate ligase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q58037 1.29e-06 52 27 8 186 1 mptN Tetrahydromethanopterin:alpha-L-glutamate ligase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A1SYG9 2.67e-06 51 25 10 228 3 rimK Probable alpha-L-glutamate ligase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A3QJ82 7.85e-06 50 25 9 227 3 rimK Probable alpha-L-glutamate ligase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8Q0M5 4.07e-05 48 23 12 292 3 mptN Tetrahydromethanopterin:alpha-L-glutamate ligase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
B7VSX1 7.72e-05 47 23 9 226 3 rimK Probable alpha-L-glutamate ligase Vibrio atlanticus (strain LGP32)
Q8TKX5 0.000201 46 23 12 290 3 mptN Tetrahydromethanopterin:alpha-L-glutamate ligase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q21J37 0.00021 45 24 9 225 3 rimK Probable alpha-L-glutamate ligase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9CMJ8 0.000294 45 29 5 132 3 rimK Probable alpha-L-glutamate ligase Pasteurella multocida (strain Pm70)
Q15S48 0.000397 45 26 10 227 3 rimK1 Probable alpha-L-glutamate ligase 1 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A6VV11 0.000662 44 25 9 226 3 rimK Probable alpha-L-glutamate ligase Marinomonas sp. (strain MWYL1)
B6EH18 0.000717 44 25 8 202 3 rimK Probable alpha-L-glutamate ligase Aliivibrio salmonicida (strain LFI1238)
Q12Y24 0.000899 43 25 9 208 3 rimK Probable alpha-L-glutamate ligase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q5E743 0.001 43 25 10 233 3 rimK Probable alpha-L-glutamate ligase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FBB1 0.001 43 25 10 233 3 rimK Probable alpha-L-glutamate ligase Aliivibrio fischeri (strain MJ11)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12390
Feature type CDS
Gene gshB
Product glutathione synthase
Location 63256 - 64206 (strand: 1)
Length 951 (nucleotides) / 316 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2041
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02951 Prokaryotic glutathione synthetase, N-terminal domain
PF02955 Prokaryotic glutathione synthetase, ATP-grasp domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0189 Amino acid transport and metabolism (E)
Coenzyme transport and metabolism (H)
Translation, ribosomal structure and biogenesis (J)
Secondary metabolites biosynthesis, transport and catabolism (Q)
EHJQ Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily

Kegg Ortholog Annotation(s)

Protein Sequence

MIKLGIVMDPIDSIKIKKDTSFAMLLEAQRRGYEIHYMEMNDLYLHQGVARARTRTLTVKEDPAGWYQFGTEQDIELGTLNTILMRKDPPFDTEFIYATYILERAESAGSLIVNKPQSLRDCNEKLFTAWFADLTPDTLVTRSEQRLRDFHKKHGDVIFKPLDGMGGASIFRLKQDDPNVGVIIETLTNHGHTFCMAQNFLPAIKDGDKRILMVDGEPVPYCLARIPAKGETRGNLAAGGHGEVRPLTESDWAIARSVAPVLKEKGLIFVGLDVIGDRLTEINVTSPTCAREIEAAHPDVSVTGMLMDAIEKRLGR

Flanking regions ( +/- flanking 50bp)

CAATCACTGCATTGCAGGTGCGTTTCGGCGATCTGGGTTAAGGAGATAAAATGATTAAGCTCGGTATTGTGATGGATCCTATCGATTCCATCAAAATCAAAAAAGACACCAGTTTCGCGATGCTGCTTGAAGCACAGCGCCGTGGTTATGAAATCCATTATATGGAGATGAACGATCTTTATCTGCATCAGGGCGTTGCCCGTGCCCGCACCCGTACACTGACGGTCAAAGAAGACCCGGCGGGCTGGTATCAGTTTGGTACGGAGCAGGATATCGAACTGGGGACACTCAATACCATTCTGATGCGCAAAGATCCGCCGTTTGATACTGAATTTATCTACGCTACCTATATCCTGGAACGCGCAGAAAGCGCCGGTTCTTTGATAGTGAACAAACCGCAAAGCCTGCGTGACTGTAATGAAAAACTGTTCACCGCCTGGTTTGCCGATTTGACACCGGACACCCTGGTCACCCGCAGTGAACAGCGCCTGCGTGATTTCCATAAAAAACACGGCGATGTGATTTTCAAACCGCTTGACGGTATGGGCGGCGCGTCCATTTTCCGCCTGAAACAAGATGATCCGAATGTCGGTGTGATTATTGAAACCCTGACCAATCATGGTCACACATTCTGTATGGCACAAAATTTCCTGCCTGCTATTAAAGACGGTGACAAACGCATTCTGATGGTGGATGGCGAGCCGGTTCCTTACTGCCTGGCACGTATTCCGGCAAAAGGTGAAACCCGCGGTAACTTAGCTGCCGGTGGTCACGGTGAAGTGCGCCCGCTGACTGAGAGCGATTGGGCGATAGCCCGCAGTGTTGCGCCGGTTCTTAAAGAAAAAGGTCTGATTTTTGTCGGACTGGATGTTATTGGTGACCGTCTGACTGAAATCAACGTAACCAGCCCGACCTGCGCCCGTGAAATTGAAGCCGCGCATCCGGATGTGTCTGTTACCGGTATGCTGATGGATGCGATTGAAAAGCGTCTCGGCCGGTAACCTGACACACGCCGTTGCGCCATCCTTCCACTTATACCCGCAGTCCGGTG