Homologs in group_2005

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15070 FBDBKF_15070 100.0 Morganella morganii S1 pulO Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase
EHELCC_11175 EHELCC_11175 100.0 Morganella morganii S2 pulO Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase
LHKJJB_11380 LHKJJB_11380 100.0 Morganella morganii S3 pulO Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase
HKOGLL_09990 HKOGLL_09990 100.0 Morganella morganii S5 pulO Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase
F4V73_RS12380 F4V73_RS12380 68.5 Morganella psychrotolerans - A24 family peptidase
PMI_RS01635 PMI_RS01635 29.9 Proteus mirabilis HI4320 - A24 family peptidase

Distribution of the homologs in the orthogroup group_2005

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2005

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P33566 9.16e-15 74 33 2 155 3 pilD Prepilin leader peptidase/N-methyltransferase Neisseria gonorrhoeae
P31712 5.21e-14 72 35 3 137 1 outO Prepilin leader peptidase/N-methyltransferase Pectobacterium carotovorum subsp. carotovorum
Q56740 1.28e-13 71 32 4 160 3 vvpD Prepilin leader peptidase/N-methyltransferase Vibrio vulnificus (strain CMCP6)
P36642 1.32e-12 68 36 3 160 3 pilD Prepilin leader peptidase/N-methyltransferase Pseudomonas putida
P31711 1.79e-12 68 32 3 143 3 outO Prepilin leader peptidase/N-methyltransferase Dickeya chrysanthemi
P15754 2.65e-12 67 40 0 93 3 pulO Prepilin leader peptidase/N-methyltransferase Klebsiella pneumoniae
P0C423 4.97e-12 67 36 4 168 3 tapD Prepilin leader peptidase/N-methyltransferase Aeromonas salmonicida
A2T195 4.97e-12 67 36 4 168 3 tapD Prepilin leader peptidase/N-methyltransferase Aeromonas salmonicida (strain A449)
P45794 1.22e-11 65 37 3 143 3 tapD Prepilin leader peptidase/N-methyltransferase Aeromonas hydrophila
P25960 2.78e-11 63 36 4 149 1 gspO Prepilin leader peptidase/N-methyltransferase Escherichia coli (strain K12)
O68932 8.81e-11 61 35 3 144 3 hopD Leader peptidase HopD Escherichia coli
O68433 1.13e-10 63 30 3 153 3 pilD Prepilin leader peptidase/N-methyltransferase Legionella pneumophila
I1WFC0 1.66e-09 60 33 1 132 3 gspO Prepilin leader peptidase/N-methyltransferase Burkholderia pseudomallei (strain 1026b)
P0DMK9 1.86e-09 59 33 1 132 3 gspO Prepilin leader peptidase/N-methyltransferase Burkholderia pseudomallei (strain K96243)
Q56763 8.12e-09 57 33 3 137 3 xpsO Prepilin leader peptidase/N-methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
O68927 1.08e-08 55 35 1 113 3 hopD Leader peptidase HopD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q46525 1.36e-07 54 32 0 101 3 fimP Prepilin leader peptidase/N-methyltransferase Dichelobacter nodosus
P0C6D9 2.57e-06 50 25 3 156 3 tcpJ Prepilin leader peptidase/N-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F385 2.57e-06 50 25 3 156 3 tcpJ Prepilin leader peptidase/N-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q46836 1.33e-05 48 30 2 136 1 pppA Prepilin peptidase PppA Escherichia coli (strain K12)
E3PJ89 4.21e-05 47 29 2 136 3 pppA Type 4 prepilin-like proteins leader peptide-processing enzyme Escherichia coli O78:H11 (strain H10407 / ETEC)
Q9ZEL6 0.000105 45 34 4 152 3 pilD Prepilin leader peptidase/N-methyltransferase Stutzerimonas stutzeri

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_11520
Feature type CDS
Gene pulO
Product Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase
Location 60947 - 61600 (strand: -1)
Length 654 (nucleotides) / 217 (amino acids)

Contig

Accession ZDB_526
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2005
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01478 Type IV leader peptidase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1989 Cell motility (N)
Intracellular trafficking, secretion, and vesicular transport (U)		 NU Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase

Protein Sequence

MDWLIMSIWGLFLPLPLKAGTEYILRHYYQYPQRLPGGWLYLHCLLSGVLIVFWSDGQGVYVLFLTLLFLCLVMLFHIDNSVFYLPDKLVFPVLWAGLLFQNEVRLVTISSALYGVIGGFFLLWSVAEGYAWCRKKSGLGGGDIKLFSASGAWVGAEQLALLLMLACVSALVVSGMQYLRYRCHHHPRCGPRIIAFGPHLIAGMIMVMGLMSGSRFQ

Flanking regions ( +/- flanking 50bp)

ATGGTCAGGCAGGCTGCGGATATCGCAACAGAGAAAGCCGCGGAGAAAATATGGACTGGCTGATTATGAGTATCTGGGGACTGTTTTTGCCGCTGCCGCTGAAAGCCGGGACGGAATATATTCTGCGCCATTACTATCAGTATCCGCAGCGGTTACCGGGCGGGTGGCTGTATCTGCACTGCCTGTTATCCGGTGTACTGATTGTGTTCTGGTCAGACGGACAGGGTGTGTATGTCCTGTTTCTGACACTGCTGTTTTTGTGCTTGGTGATGCTGTTTCATATTGATAACTCGGTATTTTATCTGCCGGATAAACTGGTGTTTCCGGTGCTGTGGGCTGGATTGCTGTTTCAGAATGAGGTCCGGCTGGTGACGATCTCTTCCGCGTTGTACGGGGTGATCGGCGGTTTTTTTCTGCTCTGGAGTGTGGCGGAAGGCTATGCCTGGTGCCGGAAAAAAAGCGGTCTGGGCGGCGGGGATATCAAACTGTTTTCTGCCTCCGGTGCCTGGGTGGGGGCGGAACAGCTCGCGCTGTTGCTGATGCTGGCCTGTGTGTCCGCGCTGGTGGTATCCGGGATGCAATATTTACGTTACCGCTGTCATCATCACCCGCGATGCGGTCCGCGCATTATTGCTTTCGGGCCGCATTTAATTGCGGGGATGATTATGGTGATGGGACTGATGTCAGGCAGTCGTTTTCAGTAACGGGATCAGCCTTTCCCAGTGTGATTCCGCACCGAGTACAGCCTGGTTCG