Homologs in group_2005

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15070 FBDBKF_15070 29.9 Morganella morganii S1 pulO Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase
EHELCC_11175 EHELCC_11175 29.9 Morganella morganii S2 pulO Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase
NLDBIP_11520 NLDBIP_11520 29.9 Morganella morganii S4 pulO Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase
LHKJJB_11380 LHKJJB_11380 29.9 Morganella morganii S3 pulO Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase
HKOGLL_09990 HKOGLL_09990 29.9 Morganella morganii S5 pulO Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase
F4V73_RS12380 F4V73_RS12380 31.1 Morganella psychrotolerans - A24 family peptidase

Distribution of the homologs in the orthogroup group_2005

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2005

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
E3PJ89 4.86e-12 66 30 3 147 3 pppA Type 4 prepilin-like proteins leader peptide-processing enzyme Escherichia coli O78:H11 (strain H10407 / ETEC)
P33566 5.11e-12 66 32 4 138 3 pilD Prepilin leader peptidase/N-methyltransferase Neisseria gonorrhoeae
Q46836 6.75e-12 66 31 3 147 1 pppA Prepilin peptidase PppA Escherichia coli (strain K12)
P25960 1.26e-11 64 38 2 140 1 gspO Prepilin leader peptidase/N-methyltransferase Escherichia coli (strain K12)
Q46525 1.52e-11 65 37 3 135 3 fimP Prepilin leader peptidase/N-methyltransferase Dichelobacter nodosus
Q56740 2.47e-11 64 27 3 187 3 vvpD Prepilin leader peptidase/N-methyltransferase Vibrio vulnificus (strain CMCP6)
P31712 1.06e-10 62 35 4 131 1 outO Prepilin leader peptidase/N-methyltransferase Pectobacterium carotovorum subsp. carotovorum
Q56763 2.1e-09 59 28 3 139 3 xpsO Prepilin leader peptidase/N-methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P36642 2.42e-09 59 28 4 148 3 pilD Prepilin leader peptidase/N-methyltransferase Pseudomonas putida
O68433 1.2e-08 57 32 6 173 3 pilD Prepilin leader peptidase/N-methyltransferase Legionella pneumophila
P31711 1.44e-08 57 31 3 136 3 outO Prepilin leader peptidase/N-methyltransferase Dickeya chrysanthemi
Q9ZEL6 1.62e-08 56 31 3 141 3 pilD Prepilin leader peptidase/N-methyltransferase Stutzerimonas stutzeri
P45794 2.86e-08 56 34 2 139 3 tapD Prepilin leader peptidase/N-methyltransferase Aeromonas hydrophila
P0C423 3.1e-08 55 33 3 143 3 tapD Prepilin leader peptidase/N-methyltransferase Aeromonas salmonicida
A2T195 3.1e-08 55 33 3 143 3 tapD Prepilin leader peptidase/N-methyltransferase Aeromonas salmonicida (strain A449)
P15754 1.66e-06 50 35 1 90 3 pulO Prepilin leader peptidase/N-methyltransferase Klebsiella pneumoniae
P0DMK9 6.75e-06 49 38 2 91 3 gspO Prepilin leader peptidase/N-methyltransferase Burkholderia pseudomallei (strain K96243)
I1WFC0 6.88e-06 49 38 2 91 3 gspO Prepilin leader peptidase/N-methyltransferase Burkholderia pseudomallei (strain 1026b)
P44620 6.91e-06 48 31 4 141 3 hofD Prepilin leader peptidase/N-methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O68927 1.54e-05 47 34 8 146 3 hopD Leader peptidase HopD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O68932 1.86e-05 46 32 5 131 3 hopD Leader peptidase HopD Escherichia coli
P22610 3.63e-05 47 30 3 141 1 pilD Prepilin leader peptidase/N-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01635
Feature type CDS
Gene -
Product A24 family peptidase
Location 390920 - 391552 (strand: 1)
Length 633 (nucleotides) / 210 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2005
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01478 Type IV leader peptidase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1989 Cell motility (N)
Intracellular trafficking, secretion, and vesicular transport (U)		 NU Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase

Protein Sequence

MLLPQNIMITMAFFTFLKGCSDYFSTSVLARLSPIRYQQLWQVYLIICFYWSFTISNYSLLILFLLFSFYLLTLSFFDADYLQLPDNLTFWLLFFGITLNLTPYGVISSTCSFYGCLVASLFFYSIYWLGYWIYQEAILGLGDVKLFSAIGAWCGIELLPYILFFAALLGIVIYMLIWAFTNVKIKQIAFGSCLAFSAIVVLRVKTIIMY

Flanking regions ( +/- flanking 50bp)

TATTTTAGAGTCCTAGATTAGGAACTCGCAAATATCAAGGATAGATATTTATGTTATTACCGCAAAACATCATGATTACAATGGCCTTTTTTACCTTTTTAAAAGGGTGTAGCGATTATTTCTCTACCTCTGTTTTAGCACGCCTCTCACCTATTCGTTATCAGCAATTGTGGCAAGTCTATTTAATTATCTGTTTTTATTGGTCTTTTACTATTTCTAATTATTCGTTATTAATATTATTTCTATTGTTTAGTTTTTACCTCTTAACTCTCTCGTTTTTCGATGCAGATTATCTTCAGCTACCTGATAACTTAACTTTTTGGTTACTTTTCTTTGGAATTACGCTTAATTTAACGCCTTATGGCGTGATTTCTTCAACTTGCTCTTTTTATGGCTGTTTAGTCGCAAGTTTGTTTTTTTATAGTATTTATTGGCTCGGTTATTGGATATATCAAGAGGCTATTTTGGGGTTGGGTGATGTAAAGCTTTTTAGTGCCATAGGCGCTTGGTGTGGAATAGAACTATTACCTTATATCCTCTTTTTCGCTGCACTATTAGGGATTGTTATTTATATGCTTATTTGGGCTTTTACTAATGTGAAGATAAAGCAGATTGCCTTTGGCTCTTGCCTTGCATTTTCAGCGATAGTTGTTTTAAGAGTAAAGACAATAATAATGTATTGAATAGGCTAATATTTCTTGCTGAATATTAAATAAGAGTGAGGTGTAGAATT