Homologs in group_101

Help

11 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16695 FBDBKF_16695 97.7 Morganella morganii S1 - PAAR domain-containing protein
FBDBKF_16705 FBDBKF_16705 100.0 Morganella morganii S1 - PAAR domain-containing protein
EHELCC_10755 EHELCC_10755 100.0 Morganella morganii S2 - PAAR domain-containing protein
EHELCC_10765 EHELCC_10765 97.7 Morganella morganii S2 - PAAR domain-containing protein
NLDBIP_11110 NLDBIP_11110 97.7 Morganella morganii S4 - PAAR domain-containing protein
LHKJJB_10245 LHKJJB_10245 97.7 Morganella morganii S3 - PAAR domain-containing protein
LHKJJB_10255 LHKJJB_10255 100.0 Morganella morganii S3 - PAAR domain-containing protein
HKOGLL_16410 HKOGLL_16410 97.7 Morganella morganii S5 - PAAR domain-containing protein
HKOGLL_16420 HKOGLL_16420 100.0 Morganella morganii S5 - PAAR domain-containing protein
F4V73_RS02385 F4V73_RS02385 37.8 Morganella psychrotolerans - PAAR domain-containing protein
PMI_RS14810 PMI_RS14810 41.9 Proteus mirabilis HI4320 - PAAR domain-containing protein

Distribution of the homologs in the orthogroup group_101

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_101

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_11100
Feature type CDS
Gene -
Product PAAR domain-containing protein
Location 170030 - 170296 (strand: 1)
Length 267 (nucleotides) / 88 (amino acids)

Contig

Accession ZDB_525
Length 191527 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_101
Orthogroup size 12
N. genomes 7

Actions

Genomic region

Domains

PF05488 PAAR motif

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4104 Intracellular trafficking, secretion, and vesicular transport (U) U Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion

Protein Sequence

MAGKQVICLGDTTDHGGVVISALDNYTINGRPVATEGDSVSCPKCKGVFQIASGSSLMTFQGKKIALEGLKTTCGATLIASQSLMVSE

Flanking regions ( +/- flanking 50bp)

AATTCCGCATGACAATGAACGGGATCTGACCCTGCTGGAGCAAAAACTCAATGGCCGGTAAACAGGTTATCTGTCTCGGTGATACGACTGACCACGGCGGCGTAGTCATCTCTGCGTTGGATAATTACACTATCAACGGCCGCCCGGTGGCAACGGAGGGCGATTCGGTCTCCTGTCCGAAATGCAAAGGTGTCTTTCAGATTGCTTCCGGTTCTTCCCTTATGACCTTTCAGGGTAAAAAAATTGCCCTGGAGGGCTTGAAAACCACCTGCGGTGCCACACTGATTGCGTCACAGTCATTGATGGTATCAGAGTAACTGCTTTTTTATCGTTCCGGCAGAATAGCATTATCAGTAAATCACAGGAG