Homologs in group_3735

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS14810 PMI_RS14810 58.8 Proteus mirabilis HI4320 - PAAR domain-containing protein

Distribution of the homologs in the orthogroup group_3735

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3735

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS02385
Feature type CDS
Gene -
Product PAAR domain-containing protein
Location 507517 - 507774 (strand: 1)
Length 258 (nucleotides) / 85 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3735
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF05488 PAAR motif

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4104 Intracellular trafficking, secretion, and vesicular transport (U) U Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion

Protein Sequence

MNQQKFIIKNDSTNTNGTVLSGHLIAKQKEEIAYLGDAVYCPRCDSTGVITEASPMMKIQGVPVALEGYQVDCDCSGGCILVAKN

Flanking regions ( +/- flanking 50bp)

GATTAATAATACACGTTATTAATAATAAAATGGCGATATGAGAGGGGGAAATAAATCAGCAGAAATTCATCATCAAAAATGATAGTACCAATACAAATGGAACCGTATTAAGCGGACATTTAATTGCCAAACAGAAAGAAGAAATAGCCTATTTGGGGGATGCCGTTTATTGCCCGCGATGTGATTCAACCGGTGTTATTACAGAAGCCAGTCCTATGATGAAAATACAAGGGGTTCCCGTAGCACTGGAAGGGTATCAGGTTGACTGTGATTGTTCCGGAGGATGCATACTGGTAGCAAAGAATTAAGAATTTAGCTTGGTGTAAACATAAATTTAAATACGTATGCAGCCAGAATA