Homologs in group_132

Help

9 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16695 FBDBKF_16695 100.0 Morganella morganii S1 - PAAR domain-containing protein
FBDBKF_16705 FBDBKF_16705 97.7 Morganella morganii S1 - PAAR domain-containing protein
EHELCC_10755 EHELCC_10755 97.7 Morganella morganii S2 - PAAR domain-containing protein
EHELCC_10765 EHELCC_10765 100.0 Morganella morganii S2 - PAAR domain-containing protein
NLDBIP_11100 NLDBIP_11100 97.7 Morganella morganii S4 - PAAR domain-containing protein
NLDBIP_11110 NLDBIP_11110 100.0 Morganella morganii S4 - PAAR domain-containing protein
LHKJJB_10255 LHKJJB_10255 97.7 Morganella morganii S3 - PAAR domain-containing protein
HKOGLL_16410 HKOGLL_16410 100.0 Morganella morganii S5 - PAAR domain-containing protein
HKOGLL_16420 HKOGLL_16420 97.7 Morganella morganii S5 - PAAR domain-containing protein

Distribution of the homologs in the orthogroup group_132

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_132

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_10245
Feature type CDS
Gene -
Product PAAR domain-containing protein
Location 19742 - 20008 (strand: -1)
Length 267 (nucleotides) / 88 (amino acids)
In genomic island -

Contig

Accession ZDB_367
Length 191445 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_132
Orthogroup size 10
N. genomes 5

Actions

Genomic region

Domains

PF05488 PAAR motif

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4104 Intracellular trafficking, secretion, and vesicular transport (U) U Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion

Protein Sequence

MAGKQVICLGDTTDHGGVVISALDNYTINGRPVATEGDSVSCPKCKGVFQIASGSSLMTFQGNKIALEGMKTTCGATLIASQSLMVSE

Flanking regions ( +/- flanking 50bp)

AATTCCGCACGATGATGAACGGGATCTGACCCTGCTGGAGCAAAAACTCAATGGCCGGTAAACAGGTTATCTGTCTCGGTGATACGACTGACCACGGCGGCGTAGTCATCTCTGCGTTGGATAATTACACTATCAACGGCCGCCCGGTGGCAACGGAGGGGGATTCAGTCTCCTGTCCGAAATGCAAAGGTGTCTTTCAGATTGCTTCCGGTTCTTCCCTCATGACCTTTCAGGGCAACAAAATTGCCCTGGAGGGAATGAAAACCACCTGTGGTGCCACACTGATTGCGTCACAGTCATTAATGGTATCAGAGTAACTGCTTTTTTATCGTTCCGGCAGAATAGCATTATCAGTAAATCACAGGAG