Homologs in group_1114

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06355 FBDBKF_06355 100.0 Morganella morganii S1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase
EHELCC_09400 EHELCC_09400 100.0 Morganella morganii S2 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase
LHKJJB_07975 LHKJJB_07975 100.0 Morganella morganii S3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase
HKOGLL_07525 HKOGLL_07525 100.0 Morganella morganii S5 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase
F4V73_RS15570 F4V73_RS15570 94.5 Morganella psychrotolerans ribB 3,4-dihydroxy-2-butanone-4-phosphate synthase
PMI_RS11640 PMI_RS11640 78.3 Proteus mirabilis HI4320 ribB 3,4-dihydroxy-2-butanone-4-phosphate synthase

Distribution of the homologs in the orthogroup group_1114

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1114

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JQV2 1.27e-132 374 82 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GJU0 1.28e-131 372 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Serratia proteamaculans (strain 568)
B1JM30 4.73e-130 368 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665V6 4.73e-130 368 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THU2 4.73e-130 368 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pestis (strain Pestoides F)
Q1CMD1 4.73e-130 368 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R7D2 4.73e-130 368 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZI56 4.73e-130 368 81 0 216 1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pestis
B2K2H0 4.73e-130 368 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C377 4.73e-130 368 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FE82 4.73e-130 368 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6D9P9 2.12e-128 363 82 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4EW41 1.05e-127 362 78 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Proteus mirabilis (strain HI4320)
Q6D8S3 6.01e-127 360 81 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MP95 3.96e-126 358 79 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Cronobacter sakazakii (strain ATCC BAA-894)
A4WEI2 2.98e-125 355 77 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Enterobacter sp. (strain 638)
A6TE29 1.63e-124 353 78 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XU43 1.1e-123 352 77 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Klebsiella pneumoniae (strain 342)
Q7N0C8 1.4e-123 351 77 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1R6T4 2.75e-123 350 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain UTI89 / UPEC)
Q8FDH9 2.75e-123 350 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AFX0 2.75e-123 350 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O1:K1 / APEC
B7N0J6 2.75e-123 350 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O81 (strain ED1a)
B7MAC3 2.75e-123 350 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIV5 2.75e-123 350 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8APS7 4.32e-123 350 77 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3YXK0 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella sonnei (strain Ss046)
P0A7J2 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella flexneri
Q0T0L7 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella flexneri serotype 5b (strain 8401)
Q32BS1 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q31WZ1 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella boydii serotype 4 (strain Sb227)
B2U1F0 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I413 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain SE11)
P0A7J0 1.47e-122 348 76 0 216 1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain K12)
B1ISB5 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TD60 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A4J8 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O9:H4 (strain HS)
B1XG46 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain K12 / DH10B)
C4ZQV9 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZJ1 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O8 (strain IAI1)
B7NJQ5 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YR87 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7J1 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O157:H7
B7LGI1 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain 55989 / EAEC)
A7ZRS4 1.47e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
P66032 1.78e-122 348 76 0 216 1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66033 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella typhi
B4TVS9 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella schwarzengrund (strain CVM19633)
C0PYW8 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella paratyphi C (strain RKS4594)
A9N5X2 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T665 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella newport (strain SL254)
B4TI45 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella heidelberg (strain SL476)
B5REF3 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ31 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella enteritidis PT4 (strain P125109)
B5FHS9 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella dublin (strain CT_02021853)
Q57JR5 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella choleraesuis (strain SC-B67)
B5F690 1.78e-122 348 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella agona (strain SL483)
B7LQC3 2.36e-122 348 75 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2VGK1 5.44e-122 347 78 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A9MPW6 1.14e-121 347 77 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BG06 1.29e-121 346 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PMU5 1.29e-121 346 76 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B1LF38 2.11e-121 346 75 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain SMS-3-5 / SECEC)
B7ND35 2.11e-121 346 75 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
C5BHH8 2.45e-120 343 75 0 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Edwardsiella ictaluri (strain 93-146)
Q2NWD7 9.16e-119 339 75 0 213 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Sodalis glossinidius (strain morsitans)
C6BVV4 3.14e-114 328 68 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q1LSL6 7.3e-114 327 71 0 211 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q6LIW0 6.61e-113 325 74 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Photobacterium profundum (strain SS9)
C4K8P2 1.07e-112 324 71 0 213 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q8KA55 2.36e-110 318 65 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A4J2L3 4.48e-110 317 69 0 215 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A0KHV1 1.08e-109 316 71 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q0I0H0 2.79e-109 315 68 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella sp. (strain MR-7)
Q0HP01 2.79e-109 315 68 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella sp. (strain MR-4)
Q7VQQ4 6.23e-109 314 66 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Blochmanniella floridana
A9KVB7 1.49e-108 313 67 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella baltica (strain OS195)
B8E3W7 1.49e-108 313 67 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella baltica (strain OS223)
A8G1K1 1.51e-108 313 68 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella sediminis (strain HAW-EB3)
A6WHL6 1.8e-108 313 67 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella baltica (strain OS185)
A3DAC1 1.8e-108 313 67 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A4SKH7 1.9e-108 313 70 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Aeromonas salmonicida (strain A449)
C4LDD2 1.98e-108 313 67 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A1RPZ7 4.98e-108 312 67 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella sp. (strain W3-18-1)
A4Y1N7 6.54e-108 311 67 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B1KNY2 6.91e-108 311 66 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella woodyi (strain ATCC 51908 / MS32)
A0KRF9 1.1e-107 311 67 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella sp. (strain ANA-3)
A3Q8W5 3.73e-107 310 68 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P57940 1.24e-106 308 70 0 211 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pasteurella multocida (strain Pm70)
A8GYS3 1.64e-106 308 68 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q0I132 9.07e-106 306 69 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Histophilus somni (strain 129Pt)
B8D6X1 9.42e-106 306 65 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57167 9.42e-106 306 65 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8L7 9.42e-106 306 65 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B0TMY9 1.73e-105 305 68 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella halifaxensis (strain HAW-EB4)
Q8EKF2 2.56e-105 305 66 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8CH19 1.11e-104 303 67 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q4QMD5 1.28e-104 303 70 1 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Haemophilus influenzae (strain 86-028NP)
B0UX44 1.29e-104 303 69 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Histophilus somni (strain 2336)
A5UDW2 3.42e-104 302 70 1 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Haemophilus influenzae (strain PittEE)
A5UHR8 6.25e-104 301 70 1 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Haemophilus influenzae (strain PittGG)
Q8D2W5 1.03e-103 301 62 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Wigglesworthia glossinidia brevipalpis
P44866 2.48e-103 300 70 1 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3IKS6 4.68e-102 297 67 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pseudoalteromonas translucida (strain TAC 125)
B8FLF4 1.77e-100 293 65 1 211 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Desulfatibacillum aliphaticivorans
P59556 3.14e-100 292 61 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A5F159 3.73e-99 290 64 1 213 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q313P5 7.78e-99 289 69 0 197 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q65W81 1.26e-98 288 65 0 211 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q3A668 2.45e-98 287 64 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
C3LWX2 3.52e-98 287 63 1 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KKP2 3.52e-98 287 63 1 216 1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A1AKS6 9.55e-97 284 63 1 211 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B7VT10 1.44e-96 283 63 1 213 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio atlanticus (strain LGP32)
Q87GR5 1.11e-95 281 62 1 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7GHE0 1.17e-95 280 60 0 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q7MFR0 3.75e-95 279 63 1 212 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio vulnificus (strain YJ016)
Q8D485 3.75e-95 279 63 1 212 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio vulnificus (strain CMCP6)
Q6AQE3 5.6e-95 279 60 0 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q07WC1 1.42e-94 278 61 1 212 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella frigidimarina (strain NCIMB 400)
Q9L6K8 2.51e-94 277 59 1 212 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Aliivibrio fischeri
A5I603 5.27e-94 276 59 0 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FXH7 5.27e-94 276 59 0 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Clostridium botulinum (strain ATCC 19397 / Type A)
B8J4Q5 1.16e-93 276 63 1 214 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q72B63 2.97e-93 275 63 0 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
C0QJB0 4.19e-93 274 61 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A1VD83 5.37e-93 274 63 0 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Nitratidesulfovibrio vulgaris (strain DP4)
P16448 1.73e-91 270 61 0 206 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio harveyi
B3EEP4 3.71e-90 267 60 0 213 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B3QWA4 3.72e-88 262 59 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q2RS98 4.85e-83 248 60 1 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q46TZ9 1.66e-77 235 59 0 196 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7NQC4 3.61e-75 228 56 0 197 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7W2M1 2.3e-74 227 59 0 194 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDL7 2.3e-74 227 59 0 194 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VSF4 2.74e-74 227 59 0 194 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8XQN1 5.06e-73 224 60 1 197 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8UE66 3.75e-71 218 52 0 196 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9JZ77 4.14e-70 221 53 0 189 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P47924 4.14e-70 226 55 1 195 1 RIBA1 Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic Arabidopsis thaliana
Q9JU97 5.48e-70 220 53 0 189 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B0K0Y9 1.08e-69 221 50 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Thermoanaerobacter sp. (strain X514)
B0KAI2 1.42e-69 220 50 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
O66679 2.43e-69 220 54 1 195 3 ribBA Riboflavin biosynthesis protein RibBA Aquifex aeolicus (strain VF5)
Q88QG4 1.58e-68 212 58 0 197 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q02008 2.21e-68 216 51 0 199 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Photobacterium leiognathi
Q882G0 2.25e-68 216 53 0 197 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9HWX4 2.38e-67 214 56 0 190 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6NLQ7 3.79e-67 216 51 1 196 1 RIBA2 Monofunctional riboflavin biosynthesis protein RIBA 2, chloroplastic Arabidopsis thaliana
Q6Z234 1.9e-66 216 52 2 196 2 RIBA1 Probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic Oryza sativa subsp. japonica
A0Q3H7 2.78e-66 213 50 1 195 3 ribBA Riboflavin biosynthesis protein RibBA Clostridium novyi (strain NT)
P51962 4.21e-66 210 52 0 196 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Photobacterium phosphoreum
Q0E079 8.64e-66 215 51 1 195 2 RIBA2 Probable bifunctional riboflavin biosynthesis protein RIBA 2, chloroplastic Oryza sativa subsp. japonica
Q3B2I6 4.15e-64 207 53 3 197 3 ribBA Riboflavin biosynthesis protein RibBA Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q9Z734 8.92e-64 206 49 0 193 3 ribBA Riboflavin biosynthesis protein RibBA Chlamydia pneumoniae
Q5A3V6 3.66e-63 197 49 1 193 1 RIB3 3,4-dihydroxy-2-butanone 4-phosphate synthase Candida albicans (strain SC5314 / ATCC MYA-2876)
A8LY38 1.12e-62 203 52 0 195 3 ribBA Riboflavin biosynthesis protein RibBA Salinispora arenicola (strain CNS-205)
O60181 1.25e-62 196 50 2 194 3 SPBC23E6.06c 3,4-dihydroxy-2-butanone 4-phosphate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P74104 1.92e-62 206 50 1 195 3 ribBA Riboflavin biosynthesis protein RibBA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5WH08 7.01e-62 201 48 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Shouchella clausii (strain KSM-K16)
A9VG50 8.98e-62 200 49 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus mycoides (strain KBAB4)
Q64YT3 1.17e-61 200 50 0 196 3 ribBA Riboflavin biosynthesis protein RibBA Bacteroides fragilis (strain YCH46)
Q5LHT1 1.17e-61 200 50 0 196 3 ribBA Riboflavin biosynthesis protein RibBA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B9IWX4 1.59e-61 200 49 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain Q1)
B7HNM8 1.59e-61 200 49 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain AH187)
Q731I5 1.66e-61 199 49 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain ATCC 10987 / NRS 248)
A4X639 1.75e-61 199 51 0 195 3 ribBA Riboflavin biosynthesis protein RibBA Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
O84736 2.27e-61 200 46 0 197 3 ribBA Riboflavin biosynthesis protein RibBA Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q8CWF6 3.62e-61 193 45 1 204 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6HE54 5.47e-61 198 49 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1EQY5 5.47e-61 198 49 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain 03BB102)
Q81MB6 5.47e-61 198 49 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus anthracis
A0RIB3 5.47e-61 198 49 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus thuringiensis (strain Al Hakam)
C3LIX7 5.47e-61 198 49 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7P7 5.47e-61 198 49 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus anthracis (strain A0248)
Q635H0 5.59e-61 198 49 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain ZK / E33L)
Q818X6 6.36e-61 198 48 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A6LHN0 6.47e-61 198 51 1 194 3 ribBA Riboflavin biosynthesis protein RibBA Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B7IWM5 7.55e-61 198 48 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain G9842)
B7HAY4 7.88e-61 198 48 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain B4264)
B7JLW6 1.17e-60 197 49 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain AH820)
Q9PLJ5 4.33e-60 197 47 0 197 3 ribBA Riboflavin biosynthesis protein RibBA Chlamydia muridarum (strain MoPn / Nigg)
A7GSD5 6.99e-60 196 47 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q8A528 8.4e-60 196 47 0 197 3 ribBA Riboflavin biosynthesis protein RibBA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q7M936 9.55e-60 194 47 1 200 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q5YTP3 9.95e-60 196 50 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Nocardia farcinica (strain IFM 10152)
Q11WK6 2.03e-59 194 49 1 192 3 ribBA Riboflavin biosynthesis protein RibBA Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q99258 1.68e-58 186 44 2 203 1 RIB3 3,4-dihydroxy-2-butanone 4-phosphate synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B1H0I0 5.87e-58 191 45 0 193 3 ribBA Riboflavin biosynthesis protein RibBA Endomicrobium trichonymphae
Q741F1 2.28e-57 190 47 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q0AXM5 2.36e-57 189 43 1 195 3 ribBA Riboflavin biosynthesis protein RibBA Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A0QI09 2.8e-57 189 47 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium avium (strain 104)
P17620 3.4e-57 189 47 1 196 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus subtilis (strain 168)
A1T8K1 1.1e-56 188 46 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B2HP67 1.41e-56 187 47 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium marinum (strain ATCC BAA-535 / M)
A0PPL6 1.47e-56 187 47 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium ulcerans (strain Agy99)
A4SFY4 2.92e-56 186 45 2 208 3 ribBA Riboflavin biosynthesis protein RibBA Chlorobium phaeovibrioides (strain DSM 265 / 1930)
O25484 5.48e-56 184 45 2 199 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
P9WHF1 5.64e-56 186 46 1 201 1 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHF0 5.64e-56 186 46 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U2B7 5.64e-56 186 46 1 201 1 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AN60 5.64e-56 186 46 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KIK4 5.64e-56 186 46 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A5V1 5.64e-56 186 46 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7MWK9 6.74e-56 185 46 1 194 3 ribBA Riboflavin biosynthesis protein RibBA Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RIG7 6.74e-56 185 46 1 194 3 ribBA Riboflavin biosynthesis protein RibBA Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
A6KWQ7 9.47e-56 185 47 0 193 3 ribBA Riboflavin biosynthesis protein RibBA Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q9ZL40 1.51e-55 183 45 2 199 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Helicobacter pylori (strain J99 / ATCC 700824)
C0ZKW2 2.3e-55 184 48 1 193 3 ribBA Riboflavin biosynthesis protein RibBA Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A4TC13 2.68e-55 184 46 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Mycolicibacterium gilvum (strain PYR-GCK)
B1MCA4 2.83e-55 184 47 3 202 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A2SQG6 3.64e-55 178 44 1 200 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
P51695 5.29e-55 183 46 2 194 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus amyloliquefaciens
Q6GFT5 5.89e-55 182 43 1 200 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain MRSA252)
Q8NW14 6.48e-55 182 43 1 200 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain MW2)
Q6G8G1 6.48e-55 182 43 1 200 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain MSSA476)
Q5HF07 7.69e-55 182 43 1 200 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain COL)
Q7A511 7.94e-55 182 43 1 200 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain N315)
Q99TA0 7.94e-55 182 43 1 200 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain Mu50 / ATCC 700699)
C0ZZE5 9.97e-55 183 46 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q0S0K2 1.76e-54 182 46 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Rhodococcus jostii (strain RHA1)
O68249 2.16e-54 180 43 1 197 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Sulfurospirillum multivorans
C5D3N0 2.49e-54 181 47 1 195 3 ribBA Riboflavin biosynthesis protein RibBA Geobacillus sp. (strain WCH70)
Q8TG90 2.57e-54 176 44 3 209 1 RIB3 3,4-dihydroxy-2-butanone 4-phosphate synthase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q7VJN5 3.04e-54 180 43 3 198 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9PHU4 3.73e-54 179 43 1 193 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8NQ52 9.16e-54 180 46 2 201 3 ribBA Riboflavin biosynthesis protein RibBA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QEG9 9.16e-54 180 46 2 201 3 ribBA Riboflavin biosynthesis protein RibBA Corynebacterium glutamicum (strain R)
Q49YJ7 2.44e-53 178 40 1 203 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A7Z675 3.44e-53 178 46 2 194 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B3H0P8 5.84e-53 177 45 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q5HNE3 6.27e-53 177 44 1 194 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P50855 1.16e-52 177 45 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Actinobacillus pleuropneumoniae
A3MZA2 1.16e-52 177 45 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q8CNU2 1.66e-52 176 43 1 194 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
B4S5Y8 3.02e-52 176 48 4 209 3 ribBA Riboflavin biosynthesis protein RibBA Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B0BTN8 1.09e-51 174 45 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B4SE30 7.86e-51 172 49 1 194 3 ribBA Riboflavin biosynthesis protein RibBA Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q6L506 5.9e-50 173 46 3 201 2 RIBA3 Probable monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic Oryza sativa subsp. japonica
Q9FN89 1.61e-49 171 45 3 199 1 RIBA3 Monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic Arabidopsis thaliana
O24752 1.1e-48 167 44 2 201 3 ribBA Riboflavin biosynthesis protein RibBA Corynebacterium ammoniagenes
Q4L7B1 1.83e-48 166 40 1 192 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus haemolyticus (strain JCSC1435)
Q60364 2.9e-28 109 33 6 217 1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O27543 5.93e-23 95 31 7 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9X2E6 1.28e-21 94 30 7 201 3 ribBA Riboflavin biosynthesis protein RibBA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8TT89 9.06e-19 84 28 7 218 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PW86 5.08e-18 82 28 6 207 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
O29766 2.12e-16 80 31 6 187 3 ribA GTP cyclohydrolase-2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O28173 1.16e-13 70 25 6 224 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_09780
Feature type CDS
Gene ribB
Product 3,4-dihydroxy-2-butanone 4-phosphate synthase
Location 105019 - 105672 (strand: -1)
Length 654 (nucleotides) / 217 (amino acids)

Contig

Accession ZDB_524
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1114
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00926 3,4-dihydroxy-2-butanone 4-phosphate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0108 Coenzyme transport and metabolism (H) H 3,4-dihydroxy-2-butanone 4-phosphate synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MNQTLLSDYGNPIERAERAIEAIRQGRGVMVLDDENRENEGDMVFAAETITVEQMALTIRHGSGIVCLCLTDERRQQLELPMMVENNSSQFKTGFTVTIEAAHGVTTGVSAADRVTTIRAAVADGAVPADLNRPGHVFPLRAQNGGVLTRRGHTEASVDLATLAGLKPYGVLCELTNDDGSMARAPEVIVFAKAHDMPVVTIDDLVQYREQLMAKAG

Flanking regions ( +/- flanking 50bp)

GATGCCCTGGTTCTGGTAATCATTTTTAATTACGATGAGGTTTATTTACCATGAATCAGACGCTGTTATCAGATTACGGCAATCCGATTGAACGTGCAGAACGTGCCATTGAAGCTATCCGTCAGGGACGGGGGGTAATGGTACTCGATGATGAAAACCGAGAAAACGAAGGCGACATGGTGTTCGCCGCCGAAACCATCACCGTTGAGCAGATGGCACTGACCATCCGTCACGGCAGCGGTATTGTGTGCCTGTGCCTGACTGACGAACGCCGTCAGCAGCTCGAGCTGCCGATGATGGTGGAGAACAACTCCAGCCAGTTCAAAACCGGCTTTACCGTCACGATTGAAGCCGCACACGGTGTGACCACCGGGGTGTCTGCGGCTGACCGCGTCACCACCATCCGCGCTGCGGTGGCTGATGGTGCTGTTCCGGCGGATCTGAACCGTCCCGGCCACGTATTCCCGCTGCGTGCACAGAACGGTGGTGTGTTAACCCGCCGCGGTCATACCGAAGCCTCTGTTGACCTGGCGACACTCGCCGGTCTGAAGCCGTACGGTGTGCTGTGTGAACTGACCAACGATGACGGCTCAATGGCCCGTGCACCGGAAGTGATTGTGTTTGCAAAAGCCCATGATATGCCGGTTGTGACTATTGATGACCTGGTGCAGTACCGTGAGCAGTTAATGGCGAAAGCGGGCTGACATCACTGACAGGGTCAGTAACTGAACAAGACTGAAATCCTGAGAATGCC