Homologs in group_1114

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06355 FBDBKF_06355 78.3 Morganella morganii S1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase
EHELCC_09400 EHELCC_09400 78.3 Morganella morganii S2 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase
NLDBIP_09780 NLDBIP_09780 78.3 Morganella morganii S4 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase
LHKJJB_07975 LHKJJB_07975 78.3 Morganella morganii S3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase
HKOGLL_07525 HKOGLL_07525 78.3 Morganella morganii S5 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase
F4V73_RS15570 F4V73_RS15570 77.0 Morganella psychrotolerans ribB 3,4-dihydroxy-2-butanone-4-phosphate synthase

Distribution of the homologs in the orthogroup group_1114

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1114

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EW41 2.49e-160 444 100 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Proteus mirabilis (strain HI4320)
C6D9P9 5.51e-136 382 82 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8GJU0 2.47e-135 381 82 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Serratia proteamaculans (strain 568)
Q6D8S3 2.95e-134 378 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JQV2 1.23e-132 374 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A6TE29 4.94e-131 370 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MP95 9.23e-131 369 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Cronobacter sakazakii (strain ATCC BAA-894)
B5XU43 2.19e-130 369 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Klebsiella pneumoniae (strain 342)
B1JM30 3.29e-129 365 79 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665V6 3.29e-129 365 79 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THU2 3.29e-129 365 79 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pestis (strain Pestoides F)
Q1CMD1 3.29e-129 365 79 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R7D2 3.29e-129 365 79 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZI56 3.29e-129 365 79 0 216 1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pestis
B2K2H0 3.29e-129 365 79 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C377 3.29e-129 365 79 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FE82 3.29e-129 365 79 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1LF38 5.76e-129 365 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain SMS-3-5 / SECEC)
B7ND35 5.76e-129 365 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A8APS7 5.76e-129 365 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MPW6 7.49e-129 365 80 0 215 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P66032 8.09e-129 364 81 0 216 1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66033 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella typhi
B4TVS9 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella schwarzengrund (strain CVM19633)
C0PYW8 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella paratyphi C (strain RKS4594)
A9N5X2 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T665 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella newport (strain SL254)
B4TI45 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella heidelberg (strain SL476)
B5REF3 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ31 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella enteritidis PT4 (strain P125109)
B5FHS9 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella dublin (strain CT_02021853)
Q57JR5 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella choleraesuis (strain SC-B67)
B5F690 8.09e-129 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella agona (strain SL483)
Q3YXK0 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella sonnei (strain Ss046)
P0A7J2 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella flexneri
Q0T0L7 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella flexneri serotype 5b (strain 8401)
Q32BS1 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q31WZ1 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella boydii serotype 4 (strain Sb227)
B2U1F0 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I413 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain SE11)
P0A7J0 1.12e-128 364 80 0 216 1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain K12)
B1ISB5 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TD60 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A4J8 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O9:H4 (strain HS)
B1XG46 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain K12 / DH10B)
C4ZQV9 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZJ1 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O8 (strain IAI1)
B7NJQ5 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YR87 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7J1 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O157:H7
B7LGI1 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain 55989 / EAEC)
A7ZRS4 1.12e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LQC3 1.45e-128 364 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WEI2 1.45e-128 364 81 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Enterobacter sp. (strain 638)
C5BHH8 4.49e-128 363 79 0 215 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Edwardsiella ictaluri (strain 93-146)
Q1R6T4 4.57e-128 363 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli (strain UTI89 / UPEC)
Q8FDH9 4.57e-128 363 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AFX0 4.57e-128 363 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O1:K1 / APEC
B7N0J6 4.57e-128 363 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O81 (strain ED1a)
B7MAC3 4.57e-128 363 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIV5 4.57e-128 363 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5BG06 5.21e-128 362 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella paratyphi A (strain AKU_12601)
Q5PMU5 5.21e-128 362 80 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q7N0C8 7.91e-127 359 79 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VGK1 1.39e-125 356 77 0 213 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NWD7 1.32e-124 354 77 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Sodalis glossinidius (strain morsitans)
Q1LSL6 1.27e-118 338 72 0 211 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
C4K8P2 2.54e-111 320 71 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q8KA55 5.67e-111 319 65 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8D6X1 1.29e-110 318 67 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57167 1.29e-110 318 67 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8L7 1.29e-110 318 67 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q7VQQ4 2.43e-110 318 66 0 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Blochmanniella floridana
C6BVV4 1.72e-109 316 66 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A4J2L3 4.14e-109 315 68 0 215 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A0KHV1 3.61e-107 310 72 1 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q0I0H0 7.28e-107 309 68 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella sp. (strain MR-7)
Q0HP01 7.28e-107 309 68 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella sp. (strain MR-4)
A3Q8W5 9.79e-107 308 68 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0I132 1.54e-106 308 69 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Histophilus somni (strain 129Pt)
Q8D2W5 1.84e-106 308 62 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Wigglesworthia glossinidia brevipalpis
A8GYS3 1.87e-106 308 67 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A4SKH7 2.3e-106 308 72 1 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Aeromonas salmonicida (strain A449)
A0KRF9 2.93e-106 307 67 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella sp. (strain ANA-3)
A9KVB7 5.71e-106 306 66 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella baltica (strain OS195)
B8E3W7 5.71e-106 306 66 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella baltica (strain OS223)
A6WHL6 6.16e-106 306 66 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella baltica (strain OS185)
A3DAC1 6.16e-106 306 66 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B0UX44 1.64e-105 305 68 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Histophilus somni (strain 2336)
A1RPZ7 3.02e-105 305 67 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella sp. (strain W3-18-1)
A4Y1N7 3.76e-105 305 67 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B0TMY9 4.39e-105 304 67 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella halifaxensis (strain HAW-EB4)
P57940 5.48e-105 304 67 0 213 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pasteurella multocida (strain Pm70)
C4LDD2 6.08e-105 304 67 0 217 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q6LIW0 8.88e-105 304 66 0 215 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Photobacterium profundum (strain SS9)
A8G1K1 1.16e-104 303 66 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella sediminis (strain HAW-EB3)
P59556 1.8e-104 303 63 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B1KNY2 2.24e-104 303 64 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella woodyi (strain ATCC 51908 / MS32)
B8CH19 4.27e-103 299 67 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q8EKF2 5.42e-103 299 66 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q4QMD5 7.02e-103 299 70 1 211 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Haemophilus influenzae (strain 86-028NP)
Q65W81 7.41e-103 299 67 0 214 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A5UDW2 1.67e-102 298 69 1 211 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Haemophilus influenzae (strain PittEE)
B8FLF4 2.29e-102 298 66 1 214 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Desulfatibacillum aliphaticivorans
A5UHR8 2.67e-102 297 69 1 211 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Haemophilus influenzae (strain PittGG)
Q3IKS6 6.65e-102 296 67 0 208 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pseudoalteromonas translucida (strain TAC 125)
P44866 1.54e-101 295 70 1 211 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3A668 5.98e-100 291 65 0 205 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A1AKS6 1.51e-98 288 62 1 219 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A7GHE0 1.65e-97 285 60 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q313P5 3.18e-97 285 63 1 215 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A5F159 1.32e-96 283 61 1 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87GR5 1.39e-96 283 64 1 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5I603 1.94e-96 282 60 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FXH7 1.94e-96 282 60 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Clostridium botulinum (strain ATCC 19397 / Type A)
Q7MFR0 2.38e-96 282 62 1 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio vulnificus (strain YJ016)
Q8D485 2.38e-96 282 62 1 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio vulnificus (strain CMCP6)
C3LWX2 7.67e-96 281 61 1 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KKP2 7.67e-96 281 61 1 216 1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q72B63 1.33e-95 280 66 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B7VT10 1.39e-95 280 63 1 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio atlanticus (strain LGP32)
B8J4Q5 1.91e-95 280 63 2 220 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A1VD83 2.09e-95 280 66 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Nitratidesulfovibrio vulgaris (strain DP4)
P16448 1.63e-94 278 61 1 218 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Vibrio harveyi
C0QJB0 7.03e-94 276 59 0 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q07WC1 5.54e-92 271 59 1 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Shewanella frigidimarina (strain NCIMB 400)
B3QWA4 4.82e-91 269 60 0 215 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B3EEP4 7.35e-91 269 62 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q6AQE3 6.99e-89 263 59 0 209 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q9L6K8 1.08e-87 260 56 1 210 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Aliivibrio fischeri
Q2RS98 8.06e-78 235 56 1 214 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q46TZ9 4.43e-77 234 57 0 195 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q7NQC4 1.77e-76 232 58 0 198 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B0K0Y9 7.67e-74 231 51 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Thermoanaerobacter sp. (strain X514)
B0KAI2 7.92e-74 231 51 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q7W2M1 1.59e-72 223 54 1 201 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDL7 1.59e-72 223 54 1 201 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VSF4 1.93e-72 222 54 1 201 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8XQN1 3.8e-71 219 58 0 190 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
O66679 6.53e-71 224 53 1 200 3 ribBA Riboflavin biosynthesis protein RibBA Aquifex aeolicus (strain VF5)
Q8UE66 1.53e-70 217 50 0 196 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9HWX4 1.89e-69 219 53 0 202 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P47924 2.38e-69 224 52 1 201 1 RIBA1 Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic Arabidopsis thaliana
Q9JZ77 5.04e-69 218 49 1 203 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JU97 8.57e-69 217 49 1 203 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q6NLQ7 1.28e-68 220 49 1 201 1 RIBA2 Monofunctional riboflavin biosynthesis protein RIBA 2, chloroplastic Arabidopsis thaliana
A9VG50 1.64e-68 218 53 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus mycoides (strain KBAB4)
Q6Z234 3.14e-68 221 49 3 213 2 RIBA1 Probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic Oryza sativa subsp. japonica
A8LY38 7.09e-68 217 51 1 210 3 ribBA Riboflavin biosynthesis protein RibBA Salinispora arenicola (strain CNS-205)
Q731I5 2.13e-67 215 53 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain ATCC 10987 / NRS 248)
B9IWX4 2.56e-67 214 53 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain Q1)
B7HNM8 2.56e-67 214 53 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain AH187)
Q818X6 3.58e-67 214 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HAY4 3.7e-67 214 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain B4264)
B7IWM5 3.7e-67 214 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain G9842)
Q6HE54 6.21e-67 214 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1EQY5 6.21e-67 214 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain 03BB102)
Q81MB6 6.21e-67 214 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus anthracis
A0RIB3 6.21e-67 214 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus thuringiensis (strain Al Hakam)
C3LIX7 6.21e-67 214 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7P7 6.21e-67 214 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus anthracis (strain A0248)
Q0E079 6.67e-67 218 48 2 212 2 RIBA2 Probable bifunctional riboflavin biosynthesis protein RIBA 2, chloroplastic Oryza sativa subsp. japonica
A7GSD5 1.09e-66 213 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7JLW6 1.42e-66 213 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain AH820)
Q882G0 1.45e-66 212 51 0 201 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q635H0 3.52e-66 212 52 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus cereus (strain ZK / E33L)
Q5WH08 3.84e-66 211 50 1 202 3 ribBA Riboflavin biosynthesis protein RibBA Shouchella clausii (strain KSM-K16)
A6LHN0 3.94e-66 212 51 1 202 3 ribBA Riboflavin biosynthesis protein RibBA Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q64YT3 6.51e-66 211 50 0 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacteroides fragilis (strain YCH46)
Q5LHT1 6.51e-66 211 50 0 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q02008 1.76e-65 209 47 0 201 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Photobacterium leiognathi
Q9Z734 2.25e-65 210 47 0 199 3 ribBA Riboflavin biosynthesis protein RibBA Chlamydia pneumoniae
A4X639 3.67e-65 209 49 1 210 3 ribBA Riboflavin biosynthesis protein RibBA Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A0Q3H7 5.08e-65 209 48 1 198 3 ribBA Riboflavin biosynthesis protein RibBA Clostridium novyi (strain NT)
P74104 9.1e-65 212 48 1 204 3 ribBA Riboflavin biosynthesis protein RibBA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5A3V6 1.81e-64 201 48 1 194 1 RIB3 3,4-dihydroxy-2-butanone 4-phosphate synthase Candida albicans (strain SC5314 / ATCC MYA-2876)
O60181 8.77e-64 199 50 2 198 3 SPBC23E6.06c 3,4-dihydroxy-2-butanone 4-phosphate synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8A528 1.23e-63 205 48 0 201 3 ribBA Riboflavin biosynthesis protein RibBA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q3B2I6 1.3e-63 205 48 1 203 3 ribBA Riboflavin biosynthesis protein RibBA Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q7MWK9 1.54e-63 205 49 1 202 3 ribBA Riboflavin biosynthesis protein RibBA Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RIG7 1.54e-63 205 49 1 202 3 ribBA Riboflavin biosynthesis protein RibBA Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q8CWF6 1.8e-63 199 49 1 200 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q88QG4 1.88e-63 199 52 0 205 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P51962 1.4e-62 201 48 0 201 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Photobacterium phosphoreum
C5D3N0 5.13e-62 201 50 1 202 3 ribBA Riboflavin biosynthesis protein RibBA Geobacillus sp. (strain WCH70)
Q0AXM5 5.44e-62 201 47 1 199 3 ribBA Riboflavin biosynthesis protein RibBA Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q7M936 1.17e-61 199 46 3 203 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
O84736 1.81e-61 200 47 0 194 3 ribBA Riboflavin biosynthesis protein RibBA Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
C0ZKW2 3.15e-61 199 51 1 198 3 ribBA Riboflavin biosynthesis protein RibBA Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q5YTP3 5.73e-61 199 49 1 205 3 ribBA Riboflavin biosynthesis protein RibBA Nocardia farcinica (strain IFM 10152)
Q9PHU4 7.31e-61 196 46 1 198 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A6KWQ7 9.09e-61 198 48 0 201 3 ribBA Riboflavin biosynthesis protein RibBA Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q11WK6 1.67e-60 197 47 1 202 3 ribBA Riboflavin biosynthesis protein RibBA Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
P17620 2.39e-60 197 49 1 194 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus subtilis (strain 168)
Q9PLJ5 3.21e-60 197 47 0 195 3 ribBA Riboflavin biosynthesis protein RibBA Chlamydia muridarum (strain MoPn / Nigg)
O25484 5.08e-60 194 46 2 203 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Helicobacter pylori (strain ATCC 700392 / 26695)
B1H0I0 8.38e-60 195 45 0 196 3 ribBA Riboflavin biosynthesis protein RibBA Endomicrobium trichonymphae
Q7VJN5 1.17e-59 194 44 2 202 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9ZL40 1.42e-59 193 46 2 203 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q99258 1.55e-59 189 47 3 201 1 RIB3 3,4-dihydroxy-2-butanone 4-phosphate synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A2SQG6 1.26e-58 187 44 1 201 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
A4SFY4 1.31e-58 192 45 1 203 3 ribBA Riboflavin biosynthesis protein RibBA Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q5HNE3 7.07e-58 190 46 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C0ZZE5 1.11e-57 191 45 1 204 3 ribBA Riboflavin biosynthesis protein RibBA Rhodococcus erythropolis (strain PR4 / NBRC 100887)
A1T8K1 1.41e-57 190 47 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q8CNU2 2.02e-57 189 45 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8NQ52 2.67e-57 189 47 2 205 3 ribBA Riboflavin biosynthesis protein RibBA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QEG9 2.67e-57 189 47 2 205 3 ribBA Riboflavin biosynthesis protein RibBA Corynebacterium glutamicum (strain R)
A0QI09 2.98e-57 189 47 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium avium (strain 104)
Q741F1 3.11e-57 189 47 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q7A511 3.85e-57 188 43 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain N315)
Q99TA0 3.85e-57 188 43 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8NW14 4.67e-57 188 43 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain MW2)
Q6G8G1 4.67e-57 188 43 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain MSSA476)
Q6GFT5 4.93e-57 188 43 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain MRSA252)
Q5HF07 6.59e-57 187 43 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus aureus (strain COL)
Q0S0K2 7.22e-57 188 45 1 204 3 ribBA Riboflavin biosynthesis protein RibBA Rhodococcus jostii (strain RHA1)
B1MCA4 9.33e-57 188 46 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
P51695 1.23e-56 187 47 1 194 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus amyloliquefaciens
Q49YJ7 1.54e-56 187 45 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8TG90 4.06e-56 181 45 3 218 1 RIB3 3,4-dihydroxy-2-butanone 4-phosphate synthase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A4TC13 4.4e-56 186 47 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycolicibacterium gilvum (strain PYR-GCK)
P9WHF1 5.58e-56 186 46 3 205 1 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHF0 5.58e-56 186 46 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U2B7 5.58e-56 186 46 3 205 1 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AN60 5.58e-56 186 46 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KIK4 5.58e-56 186 46 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A5V1 5.58e-56 186 46 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B2HP67 5.89e-56 186 47 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium marinum (strain ATCC BAA-535 / M)
A0PPL6 6.77e-56 186 47 3 205 3 ribBA Riboflavin biosynthesis protein RibBA Mycobacterium ulcerans (strain Agy99)
A7Z675 4.86e-55 183 46 1 194 3 ribBA Riboflavin biosynthesis protein RibBA Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
O68249 6.92e-55 181 43 1 199 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Sulfurospirillum multivorans
B3H0P8 4.34e-54 181 44 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
P50855 4.53e-54 181 44 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Actinobacillus pleuropneumoniae
A3MZA2 4.53e-54 181 44 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q6L506 3.87e-53 181 46 3 205 2 RIBA3 Probable monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic Oryza sativa subsp. japonica
B0BTN8 8.48e-53 177 44 1 201 3 ribBA Riboflavin biosynthesis protein RibBA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B4S5Y8 9.57e-53 177 46 1 203 3 ribBA Riboflavin biosynthesis protein RibBA Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q4L7B1 1.3e-52 176 42 1 197 3 ribBA Riboflavin biosynthesis protein RibBA Staphylococcus haemolyticus (strain JCSC1435)
Q9FN89 2.96e-52 178 45 3 203 1 RIBA3 Monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic Arabidopsis thaliana
O24752 4.44e-52 176 45 2 205 3 ribBA Riboflavin biosynthesis protein RibBA Corynebacterium ammoniagenes
B4SE30 1.24e-50 172 45 1 203 3 ribBA Riboflavin biosynthesis protein RibBA Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q60364 8.13e-28 108 29 5 222 1 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O27543 4.86e-27 106 33 7 216 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8PW86 7.07e-22 93 29 6 228 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8TT89 1.08e-21 92 28 8 244 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9X2E6 1.25e-20 92 31 6 205 3 ribBA Riboflavin biosynthesis protein RibBA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O29766 8.22e-18 84 30 5 192 3 ribA GTP cyclohydrolase-2 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O28173 4.17e-14 72 26 6 213 3 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS11640
Feature type CDS
Gene ribB
Product 3,4-dihydroxy-2-butanone-4-phosphate synthase
Location 2572099 - 2572752 (strand: -1)
Length 654 (nucleotides) / 217 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1114
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00926 3,4-dihydroxy-2-butanone 4-phosphate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0108 Coenzyme transport and metabolism (H) H 3,4-dihydroxy-2-butanone 4-phosphate synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MNQTLLSEFGSPLERVERALEALRAGKGVMVLDDENRENEGDMVFVAETMTTEQMAMSIRHGSGIVCVCITEERRQQLDLPMMVENNTSHFHTAFTVTIEAAQGVTTGVSAADRLTTVRAAAADNAKPSDLNRPGHVFPLRAQPGGVLTRGGHTEASIDLATLAGFKPVAVLCELTNDDGTMARAPEVVTFAKQHDMPVLTIEDLVAYRLREEKKAG

Flanking regions ( +/- flanking 50bp)

AGACTGCCCTGGTTCTGGTAACTTTCATTAATTATTGAGGTTTTTTTACCATGAATCAGACGCTACTTTCCGAATTTGGCTCTCCATTAGAGCGTGTTGAGCGTGCGCTTGAAGCCCTTCGTGCCGGTAAAGGTGTGATGGTGCTTGATGATGAGAACCGTGAAAATGAAGGCGATATGGTATTTGTCGCAGAAACCATGACCACAGAACAAATGGCGATGTCTATTCGTCATGGCAGTGGTATTGTGTGTGTCTGTATTACCGAAGAGCGCCGTCAACAACTCGATTTACCTATGATGGTAGAAAATAACACCAGTCATTTTCATACCGCATTTACGGTAACTATTGAAGCGGCCCAAGGGGTGACTACGGGAGTTTCAGCAGCAGACCGTTTAACGACAGTACGTGCAGCTGCTGCTGATAATGCAAAACCAAGTGATTTAAATCGTCCAGGTCACGTATTCCCATTACGAGCACAACCTGGTGGTGTATTAACACGTGGTGGACATACTGAAGCTTCTATTGATTTAGCAACGTTAGCGGGTTTTAAACCTGTTGCCGTGTTATGTGAATTAACCAATGACGATGGCACCATGGCCAGAGCGCCAGAAGTTGTCACTTTTGCTAAACAGCATGATATGCCAGTGTTAACGATTGAAGATTTAGTGGCTTATCGTCTTCGCGAGGAGAAGAAAGCGGGCTGAAATTAACAAGTTAAAACGACACTGAAAACACACACACACTTATTCAAGCC