Homologs in group_1842

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13395 FBDBKF_13395 100.0 Morganella morganii S1 ihfA integration host factor subunit alpha
EHELCC_08700 EHELCC_08700 100.0 Morganella morganii S2 ihfA integration host factor subunit alpha
LHKJJB_05240 LHKJJB_05240 100.0 Morganella morganii S3 ihfA integration host factor subunit alpha
HKOGLL_05675 HKOGLL_05675 100.0 Morganella morganii S5 ihfA integration host factor subunit alpha
F4V73_RS03365 F4V73_RS03365 99.0 Morganella psychrotolerans ihfA integration host factor subunit alpha
PMI_RS05055 PMI_RS05055 90.8 Proteus mirabilis HI4320 ihfA integration host factor subunit alpha

Distribution of the homologs in the orthogroup group_1842

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1842

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N3Q2 6.42e-62 186 93 0 98 3 ihfA Integration host factor subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JJ23 1.34e-60 182 91 0 98 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q9X9F6 1.34e-60 182 91 0 98 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIL7 1.34e-60 182 91 0 98 3 ihfA Integration host factor subunit alpha Yersinia pestis (strain Pestoides F)
Q1CIH0 1.34e-60 182 91 0 98 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0A2 1.34e-60 182 91 0 98 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX2 1.34e-60 182 91 0 98 3 ihfA Integration host factor subunit alpha Yersinia pestis
B2K662 1.34e-60 182 91 0 98 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C735 1.34e-60 182 91 0 98 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHG7 1.34e-60 182 91 0 98 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JMM4 1.34e-60 182 91 0 98 3 ihfA Integration host factor subunit alpha Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GDR1 5.3e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Serratia proteamaculans (strain 568)
B4ETL2 7.36e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Proteus mirabilis (strain HI4320)
C5B852 9.79e-60 180 89 0 98 3 ihfA Integration host factor subunit alpha Edwardsiella ictaluri (strain 93-146)
P23302 2.54e-59 179 90 0 97 3 ihfA Integration host factor subunit alpha Serratia marcescens
B2VEL2 2.71e-59 179 90 0 98 3 ihfA Integration host factor subunit alpha Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P37982 5.79e-59 178 89 0 98 3 ihfA Integration host factor subunit alpha Dickeya dadantii (strain 3937)
C6DFZ2 6.47e-59 178 89 0 98 3 ihfA Integration host factor subunit alpha Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4H4 6.47e-59 178 89 0 98 3 ihfA Integration host factor subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NT26 1.25e-58 177 88 0 98 3 ihfA Integration host factor subunit alpha Sodalis glossinidius (strain morsitans)
P0A1S0 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1S1 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella typhi
B4TUF6 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella schwarzengrund (strain CVM19633)
B5BA36 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella paratyphi A (strain AKU_12601)
C0Q640 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella paratyphi C (strain RKS4594)
A9N236 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PH86 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4N4 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella newport (strain SL254)
B4TGH7 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella heidelberg (strain SL476)
B5RAW7 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW2 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella enteritidis PT4 (strain P125109)
B5FJA2 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella dublin (strain CT_02021853)
Q57PU7 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella choleraesuis (strain SC-B67)
B5F7F6 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella agona (strain SL483)
A8AHA5 4.17e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MNY7 4.56e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
A4W9M9 5.31e-58 176 88 0 97 3 ihfA Integration host factor subunit alpha Enterobacter sp. (strain 638)
A9MFB7 6.26e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TAI1 1.29e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XQD2 1.29e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Klebsiella pneumoniae (strain 342)
Q3Z260 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Shigella sonnei (strain Ss046)
P0A6Y0 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Shigella flexneri
Q0T4S2 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Shigella flexneri serotype 5b (strain 8401)
Q32FI7 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Shigella dysenteriae serotype 1 (strain Sd197)
Q321K4 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Shigella boydii serotype 4 (strain Sb227)
B2U390 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LQ77 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RB83 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain UTI89 / UPEC)
B1LE18 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain SMS-3-5 / SECEC)
B6I8Q5 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain SE11)
B7N550 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6X7 1.58e-57 175 86 0 98 1 ihfA Integration host factor subunit alpha Escherichia coli (strain K12)
B1IPL5 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6X8 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THB6 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1XG19 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain K12 / DH10B)
C4ZYH4 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1C1 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O8 (strain IAI1)
B7MVJ1 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O81 (strain ED1a)
B7NT64 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQ00 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6X9 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O157:H7
B7L6I5 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain 55989 / EAEC)
B7MAS3 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O45:K1 (strain S88 / ExPEC)
B7US95 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZMI0 1.58e-57 175 86 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O139:H28 (strain E24377A / ETEC)
A8A0Q4 7.82e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O9:H4 (strain HS)
Q7MK44 1.57e-53 164 85 0 92 3 ihfA Integration host factor subunit alpha Vibrio vulnificus (strain YJ016)
Q8DA35 1.57e-53 164 85 0 92 3 ihfA Integration host factor subunit alpha Vibrio vulnificus (strain CMCP6)
B4RS41 4.13e-53 164 82 0 96 3 ihfA Integration host factor subunit alpha Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
C3LLR8 2.56e-52 161 83 0 92 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain M66-2)
Q9KSN4 2.56e-52 161 83 0 92 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1W7 2.56e-52 161 83 0 92 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87Q56 3.44e-52 161 83 0 92 3 ihfA Integration host factor subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MVH4 3.64e-52 161 83 0 92 3 ihfA Integration host factor subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
Q15SX9 9.04e-52 160 79 0 98 3 ihfA Integration host factor subunit alpha Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A3QF32 2.74e-51 159 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B7VPF6 3.56e-51 159 82 0 92 3 ihfA Integration host factor subunit alpha Vibrio atlanticus (strain LGP32)
B1KRE5 4.35e-51 158 77 0 97 3 ihfA Integration host factor subunit alpha Shewanella woodyi (strain ATCC 51908 / MS32)
A8FWI0 4.84e-51 158 77 0 97 3 ihfA Integration host factor subunit alpha Shewanella sediminis (strain HAW-EB3)
B8CR59 4.84e-51 158 77 0 97 3 ihfA Integration host factor subunit alpha Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H5F1 4.84e-51 158 77 0 97 3 ihfA Integration host factor subunit alpha Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TQY4 4.84e-51 158 77 0 97 3 ihfA Integration host factor subunit alpha Shewanella halifaxensis (strain HAW-EB4)
Q12NT8 8.65e-51 158 80 0 94 3 ihfA Integration host factor subunit alpha Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1S700 1.15e-50 157 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A0KKP3 1.18e-50 157 75 0 98 3 ihfA Integration host factor subunit alpha Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B8GRI6 5.4e-50 155 82 0 92 3 ihfA Integration host factor subunit alpha Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q083K5 5.52e-50 155 78 0 94 3 ihfA Integration host factor subunit alpha Shewanella frigidimarina (strain NCIMB 400)
Q0HUQ0 6.25e-50 155 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain MR-7)
Q0HJ83 6.25e-50 155 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain MR-4)
Q3IIL3 6.73e-50 155 76 0 97 3 ihfA Integration host factor subunit alpha Pseudoalteromonas translucida (strain TAC 125)
A4VM16 7.58e-50 155 82 0 91 3 ihfA Integration host factor subunit alpha Stutzerimonas stutzeri (strain A1501)
A1RK12 1.08e-49 155 78 0 94 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain W3-18-1)
A4Y6H0 1.08e-49 155 78 0 94 3 ihfA Integration host factor subunit alpha Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KYZ2 1.08e-49 155 78 0 94 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS195)
A6WMK6 1.08e-49 155 78 0 94 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS185)
A3D3R8 1.08e-49 155 78 0 94 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E7F3 1.08e-49 155 78 0 94 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS223)
Q4ZUG1 1.14e-49 155 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas syringae pv. syringae (strain B728a)
Q883H6 1.14e-49 155 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KEX6 1.14e-49 155 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain Pf0-1)
C3JZN1 1.14e-49 155 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain SBW25)
Q4KEV8 1.14e-49 155 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48JR7 1.14e-49 155 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A0KWC7 1.3e-49 155 78 0 94 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain ANA-3)
Q8EF98 1.33e-49 155 78 0 94 3 ihfA Integration host factor subunit alpha Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q1IC09 1.39e-49 155 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas entomophila (strain L48)
B1J6V0 2.22e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain W619)
P0A127 2.22e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas putida
P0A126 2.22e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KKR2 2.22e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain GB-1)
A5W5D5 2.22e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q51472 2.73e-49 154 81 0 91 1 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NN5 2.73e-49 154 81 0 91 1 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V491 2.73e-49 154 81 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain PA7)
A4XTS7 4.24e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas mendocina (strain ymp)
B7V312 5.11e-49 153 81 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain LESB58)
Q47ZS6 8.72e-49 152 78 0 92 3 ihfA Integration host factor subunit alpha Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B5FDX6 2.11e-48 152 77 0 92 3 ihfA Integration host factor subunit alpha Aliivibrio fischeri (strain MJ11)
Q5E5G4 2.11e-48 152 77 0 92 3 ihfA Integration host factor subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EN06 2.41e-48 151 77 0 92 3 ihfA Integration host factor subunit alpha Aliivibrio salmonicida (strain LFI1238)
C4LFG7 4.99e-48 151 73 0 96 3 ihfA Integration host factor subunit alpha Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q3JBZ6 4.4e-47 148 75 0 92 3 ihfA Integration host factor subunit alpha Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A1WU59 8.75e-47 147 76 0 92 3 ihfA Integration host factor subunit alpha Halorhodospira halophila (strain DSM 244 / SL1)
Q21KD4 9.98e-47 147 78 0 91 3 ihfA Integration host factor subunit alpha Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9CN18 1.24e-46 147 71 0 97 3 ihfA Integration host factor subunit alpha Pasteurella multocida (strain Pm70)
Q2SDJ8 3.27e-46 146 76 0 91 3 ihfA Integration host factor subunit alpha Hahella chejuensis (strain KCTC 2396)
Q0AAM1 3.52e-46 146 76 0 92 3 ihfA Integration host factor subunit alpha Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1U2B7 1.45e-45 144 75 0 91 3 ihfA Integration host factor subunit alpha Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5QXL9 1.72e-45 144 71 0 98 3 ihfA Integration host factor subunit alpha Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A6VP80 3.92e-45 143 69 0 97 3 ihfA Integration host factor subunit alpha Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q057Y8 4.04e-45 144 75 0 92 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q0VNG4 6.98e-45 143 75 0 91 3 ihfA Integration host factor subunit alpha Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1SUQ7 1.06e-44 142 70 0 96 3 ihfA Integration host factor subunit alpha Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q83C16 1.76e-44 142 72 1 99 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N8J9 1.76e-44 142 72 1 99 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KGB5 1.76e-44 142 72 1 99 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain Dugway 5J108-111)
B6IZG2 1.76e-44 142 72 1 99 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain CbuG_Q212)
B6J7X5 1.76e-44 142 72 1 99 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain CbuK_Q154)
Q1QWK1 3.52e-44 141 73 0 91 3 ihfA Integration host factor subunit alpha Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q60AY8 4.16e-43 139 75 0 92 3 ihfA Integration host factor subunit alpha Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B2FN73 1.86e-42 137 71 0 92 3 ihfA Integration host factor subunit alpha Stenotrophomonas maltophilia (strain K279a)
B4SQG8 1.86e-42 137 71 0 92 3 ihfA Integration host factor subunit alpha Stenotrophomonas maltophilia (strain R551-3)
Q2YBS0 3.38e-42 136 71 0 94 3 ihfA Integration host factor subunit alpha Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A6VYH5 3.89e-42 136 72 0 91 3 ihfA Integration host factor subunit alpha Marinomonas sp. (strain MWYL1)
Q5GXY6 3.96e-42 136 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P101 3.96e-42 136 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BRU3 3.96e-42 136 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P0A0T9 3.96e-42 136 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RRH5 3.96e-42 136 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain B100)
Q4UW51 3.96e-42 136 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain 8004)
P0A0U0 3.96e-42 136 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas axonopodis pv. citri (strain 306)
Q5P7Y1 1.24e-41 135 70 0 93 3 ihfA Integration host factor subunit alpha Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q65TL4 1.65e-41 134 65 0 97 3 ihfA Integration host factor subunit alpha Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q1GZS3 1.74e-41 134 67 0 94 3 ihfA Integration host factor subunit alpha Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B0UU60 5.6e-41 133 68 1 97 3 ihfA Integration host factor subunit alpha Histophilus somni (strain 2336)
Q0I3K4 5.6e-41 133 68 1 97 3 ihfA Integration host factor subunit alpha Histophilus somni (strain 129Pt)
Q7NYC0 6.26e-41 133 68 0 93 3 ihfA Integration host factor subunit alpha Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A1K4E7 6.35e-41 133 69 0 93 3 ihfA Integration host factor subunit alpha Azoarcus sp. (strain BH72)
Q47CN0 7.71e-41 132 70 0 92 3 ihfA2 Integration host factor subunit alpha 2 Dechloromonas aromatica (strain RCB)
Q5ZS10 8.63e-41 132 69 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WT88 9.17e-41 132 69 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Lens)
A5IAL5 9.17e-41 132 69 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Corby)
Q5X1H9 9.17e-41 132 69 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Paris)
B0V5Q4 2.96e-40 131 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AYE)
A3M2B0 2.96e-40 131 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VV83 2.96e-40 131 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain SDF)
B2HTI2 2.96e-40 131 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain ACICU)
B7I698 2.96e-40 131 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AB0057)
B7GZZ4 2.96e-40 131 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AB307-0294)
Q31F20 3.27e-40 131 63 0 92 3 ihfA Integration host factor subunit alpha Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A1KSZ1 4.31e-40 130 62 1 99 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P64393 4.31e-40 130 62 1 99 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64392 4.31e-40 130 62 1 99 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M383 4.31e-40 130 62 1 99 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup C (strain 053442)
B4RJZ4 7.97e-40 130 62 1 99 3 ihfA Integration host factor subunit alpha Neisseria gonorrhoeae (strain NCCP11945)
Q5F9T5 7.97e-40 130 62 1 99 3 ihfA Integration host factor subunit alpha Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q6F874 8.68e-40 130 66 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P43723 8.9e-40 130 64 0 93 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKM2 8.9e-40 130 64 0 93 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain 86-028NP)
Q82VV7 1.01e-39 130 67 0 92 3 ihfA Integration host factor subunit alpha Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q63TM8 1.35e-39 130 72 0 90 3 ihfA Integration host factor subunit alpha Burkholderia pseudomallei (strain K96243)
Q0ADP0 1.36e-39 129 67 0 92 3 ihfA Integration host factor subunit alpha Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8XZ23 3.27e-39 129 69 0 91 3 ihfA Integration host factor subunit alpha Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A5UF06 3.87e-39 128 64 0 93 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain PittGG)
Q9PFD5 4e-39 128 67 0 92 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain 9a5c)
Q9F297 6.99e-39 127 63 1 94 3 ihfA Integration host factor subunit alpha (Fragment) Neisseria gonorrhoeae
A5EXT4 1.04e-38 127 60 0 97 3 ihfA Integration host factor subunit alpha Dichelobacter nodosus (strain VCS1703A)
Q87AB7 1.4e-38 127 66 0 92 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5D7 1.4e-38 127 66 0 92 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain M12)
B2I9P2 1.4e-38 127 66 0 92 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain M23)
Q2KZM3 9.13e-38 125 66 0 92 3 ihfA Integration host factor subunit alpha Bordetella avium (strain 197N)
Q3SK28 2e-37 124 66 0 90 3 ihfA Integration host factor subunit alpha Thiobacillus denitrificans (strain ATCC 25259)
Q7W7C5 5.8e-37 123 64 0 93 3 ihfA Integration host factor subunit alpha Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKR3 5.8e-37 123 64 0 93 3 ihfA Integration host factor subunit alpha Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VVR6 8.32e-37 123 65 0 91 3 ihfA Integration host factor subunit alpha Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P95516 3e-35 119 64 0 97 3 ihfA Integration host factor subunit alpha Mannheimia haemolytica
B8F4T7 2.97e-34 116 65 0 97 3 ihfA Integration host factor subunit alpha Glaesserella parasuis serovar 5 (strain SH0165)
Q47GF4 5.53e-34 115 56 0 94 3 ihfA1 Integration host factor subunit alpha 1 Dechloromonas aromatica (strain RCB)
Q8KA11 3.47e-33 113 69 0 92 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q21YS7 5.45e-33 113 60 0 91 3 ihfA Integration host factor subunit alpha Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B0BNN9 1.71e-32 111 68 0 92 3 ihfA Integration host factor subunit alpha Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H139 1.71e-32 111 68 0 92 3 ihfA Integration host factor subunit alpha Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZX6 1.71e-32 111 68 0 92 3 ihfA Integration host factor subunit alpha Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q4FQ67 1.74e-32 111 55 0 92 3 ihfA Integration host factor subunit alpha Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q8C9 2.17e-32 111 55 0 92 3 ihfA Integration host factor subunit alpha Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A5UCA8 2.7e-32 111 63 0 93 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain PittEE)
A9C3C8 9.42e-32 110 55 0 94 3 ihfA Integration host factor subunit alpha Delftia acidovorans (strain DSM 14801 / SPH-1)
Q6MMJ0 1.37e-31 109 57 0 87 3 ihfA Integration host factor subunit alpha Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B8D736 2.02e-31 109 68 0 91 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57231 2.02e-31 109 68 0 91 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8T2 2.02e-31 109 68 0 91 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q12BQ7 5.23e-31 108 54 0 91 3 ihfA Integration host factor subunit alpha Polaromonas sp. (strain JS666 / ATCC BAA-500)
B4UAP1 1.79e-30 107 54 0 86 3 ihfA Integration host factor subunit alpha Anaeromyxobacter sp. (strain K)
B8J836 1.79e-30 107 54 0 86 3 ihfA Integration host factor subunit alpha Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IJA7 1.81e-30 107 54 0 86 3 ihfA Integration host factor subunit alpha Anaeromyxobacter dehalogenans (strain 2CP-C)
A7HBJ3 8.95e-30 105 53 0 86 3 ihfA Integration host factor subunit alpha Anaeromyxobacter sp. (strain Fw109-5)
A1VR71 2.31e-29 104 52 0 94 3 ihfA Integration host factor subunit alpha Polaromonas naphthalenivorans (strain CJ2)
Q7VLG4 1.9e-28 101 59 0 92 3 ihfA Integration host factor subunit alpha Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q1D6D8 4.29e-28 101 47 0 96 3 ihfA Integration host factor subunit alpha Myxococcus xanthus (strain DK1622)
Q9K4Q3 4.29e-28 101 47 0 96 3 ihfA Integration host factor subunit alpha Myxococcus xanthus
Q2W4R6 8.45e-27 97 48 0 89 3 ihfA Integration host factor subunit alpha Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2N927 3.06e-26 95 48 0 91 3 ihfA Integration host factor subunit alpha Erythrobacter litoralis (strain HTCC2594)
Q2RTS7 7.23e-26 95 46 0 89 3 ihfA Integration host factor subunit alpha Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B4RB18 2.87e-25 93 46 0 95 3 ihfA Integration host factor subunit alpha Phenylobacterium zucineum (strain HLK1)
A8I5K8 5.77e-25 92 45 0 95 3 ihfA Integration host factor subunit alpha Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A6X1X7 5.77e-25 93 47 0 89 3 ihfA Integration host factor subunit alpha Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q1MIS5 6.56e-25 93 45 0 92 3 ihfA Integration host factor subunit alpha Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P64391 6.73e-25 92 47 0 89 3 ihfA Integration host factor subunit alpha Brucella suis biovar 1 (strain 1330)
P64390 6.73e-25 92 47 0 89 3 ihfA Integration host factor subunit alpha Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RIB4 6.73e-25 92 47 0 89 3 ihfA Integration host factor subunit alpha Brucella melitensis biotype 2 (strain ATCC 23457)
A9MAF7 6.73e-25 92 47 0 89 3 ihfA Integration host factor subunit alpha Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57DX3 6.73e-25 92 47 0 89 3 ihfA Integration host factor subunit alpha Brucella abortus biovar 1 (strain 9-941)
Q2YNB8 6.73e-25 92 47 0 89 3 ihfA Integration host factor subunit alpha Brucella abortus (strain 2308)
B2S525 6.73e-25 92 47 0 89 3 ihfA Integration host factor subunit alpha Brucella abortus (strain S19)
Q1GT91 7.8e-25 92 44 0 89 3 ihfA Integration host factor subunit alpha Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A5VC87 7.86e-25 92 48 0 89 3 ihfA Integration host factor subunit alpha Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B5ZXV9 8.16e-25 92 45 0 92 3 ihfA Integration host factor subunit alpha Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q0APH3 9.42e-25 92 45 0 96 3 ihfA Integration host factor subunit alpha Maricaulis maris (strain MCS10)
A1B366 1e-24 92 47 0 89 3 ihfA Integration host factor subunit alpha Paracoccus denitrificans (strain Pd 1222)
C3M9J7 1.07e-24 92 45 0 92 3 ihfA Integration host factor subunit alpha Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9RNZ5 1.13e-24 92 44 0 93 3 ihfA Integration host factor subunit alpha Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B9JCZ0 1.2e-24 92 44 0 92 3 ihfA Integration host factor subunit alpha Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q2KA00 1.64e-24 92 44 0 93 3 ihfA Integration host factor subunit alpha Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PVE1 1.75e-24 92 44 0 92 3 ihfA Integration host factor subunit alpha Rhizobium etli (strain CIAT 652)
A6U7Q6 1.77e-24 92 45 0 92 3 ihfA Integration host factor subunit alpha Sinorhizobium medicae (strain WSM419)
Q92QT3 1.77e-24 92 45 0 92 3 ihfA Integration host factor subunit alpha Rhizobium meliloti (strain 1021)
B0CLA3 1.8e-24 91 47 0 89 3 ihfA Integration host factor subunit alpha Brucella suis (strain ATCC 23445 / NCTC 10510)
B0T0T0 4.18e-24 90 47 0 92 3 ihfA Integration host factor subunit alpha Caulobacter sp. (strain K31)
Q11J82 4.55e-24 90 43 0 89 3 ihfA Integration host factor subunit alpha Chelativorans sp. (strain BNC1)
Q8UG61 5.34e-24 90 43 0 92 3 ihfA Integration host factor subunit alpha Agrobacterium fabrum (strain C58 / ATCC 33970)
A4WTU0 7.15e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3J366 7.15e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PJ63 7.15e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q5LQJ4 1.04e-23 89 47 0 89 3 ihfA Integration host factor subunit alpha Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q1GI70 1.16e-23 89 45 0 90 3 ihfA Integration host factor subunit alpha Ruegeria sp. (strain TM1040)
Q214G0 1.49e-23 89 44 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisB18)
Q07MS0 1.97e-23 89 44 0 90 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisA53)
B3QJM1 2.62e-23 89 44 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain TIE-1)
Q6N676 2.62e-23 89 44 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q982Z7 2.73e-23 89 44 0 92 3 ihfA Integration host factor subunit alpha Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2IWQ7 2.84e-23 89 44 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain HaA2)
A7INL3 3.01e-23 88 43 0 89 3 ihfA Integration host factor subunit alpha Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A5EKG4 3.32e-23 89 44 0 90 3 ihfA Integration host factor subunit alpha Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B8H546 3.52e-23 88 46 0 92 3 ihfA Integration host factor subunit alpha Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8I3 3.52e-23 88 46 0 92 3 ihfA Integration host factor subunit alpha Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q3SSS2 3.6e-23 88 44 0 90 3 ihfA Integration host factor subunit alpha Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A4YW83 3.86e-23 88 44 0 89 3 ihfA Integration host factor subunit alpha Bradyrhizobium sp. (strain ORS 278)
Q136S3 4.08e-23 89 44 0 90 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisB5)
P30787 4.58e-23 88 44 0 90 1 ihfA Integration host factor subunit alpha Rhodobacter capsulatus
Q6FZZ9 4.68e-23 88 45 0 92 3 ihfA Integration host factor subunit alpha Bartonella quintana (strain Toulouse)
Q28RG2 5e-23 87 46 0 89 3 ihfA Integration host factor subunit alpha Jannaschia sp. (strain CCS1)
Q1QMY9 6.79e-23 87 44 0 89 3 ihfA Integration host factor subunit alpha Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B9JV88 7.4e-23 87 42 0 92 3 ihfA Integration host factor subunit alpha Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B6JGR8 9.62e-23 87 43 0 89 3 ihfA Integration host factor subunit alpha Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B0UR46 1.2e-22 87 43 0 89 3 ihfA Integration host factor subunit alpha Methylobacterium sp. (strain 4-46)
A9IVB2 2.12e-22 86 46 0 89 3 ihfA Integration host factor subunit alpha Bartonella tribocorum (strain CIP 105476 / IBS 506)
A8LLT5 2.61e-22 86 44 0 89 3 ihfA Integration host factor subunit alpha Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q6G3K3 2.96e-22 86 46 0 89 3 ihfA Integration host factor subunit alpha Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B1LZ99 7.91e-22 85 43 0 89 3 ihfA Integration host factor subunit alpha Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A1USJ0 2.04e-21 84 44 0 89 3 ihfA Integration host factor subunit alpha Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
P08821 3.54e-21 82 42 0 89 1 hbs DNA-binding protein HU 1 Bacillus subtilis (strain 168)
A9W4E5 5.05e-21 83 42 0 89 3 ihfA Integration host factor subunit alpha Methylorubrum extorquens (strain PA1)
B7KYG6 5.05e-21 83 42 0 89 3 ihfA Integration host factor subunit alpha Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B1ZKI7 1.07e-20 82 42 0 89 3 ihfA Integration host factor subunit alpha Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q9K7K5 3.29e-20 80 40 0 89 3 hup2 DNA-binding protein HU-1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7A0U9 3.4e-20 80 41 0 89 3 hup DNA-binding protein HU Staphylococcus aureus (strain MW2)
Q6G990 3.4e-20 80 41 0 89 3 hup DNA-binding protein HU Staphylococcus aureus (strain MSSA476)
Q6GGT8 3.4e-20 80 41 0 89 3 hup DNA-binding protein HU Staphylococcus aureus (strain MRSA252)
Q7A5J1 3.4e-20 80 41 0 89 1 hup DNA-binding protein HU Staphylococcus aureus (strain N315)
Q99U17 3.4e-20 80 41 0 89 1 hup DNA-binding protein HU Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFV0 3.4e-20 80 41 0 89 3 hup DNA-binding protein HU Staphylococcus aureus (strain COL)
P0A3H0 1.05e-19 79 41 0 89 1 hup DNA-binding protein HU Geobacillus stearothermophilus
P0A3H1 1.05e-19 79 41 0 89 1 hup DNA-binding protein HU Bacillus caldolyticus
P0A3H2 1.05e-19 79 41 0 89 3 hup DNA-binding protein HU Bacillus caldotenax
Q9KDA5 3.37e-19 77 40 0 89 3 hup1 DNA-binding protein HU-1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KQS9 6.42e-19 77 40 0 86 3 hupB DNA-binding protein HU-beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5UBN4 1.45e-18 76 41 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain PittEE)
Q4QJU8 1.45e-18 76 41 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain 86-028NP)
Q9XB21 2.05e-18 75 41 0 84 1 hup DNA-binding protein HU Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P96045 4.3e-18 75 40 0 84 3 hup DNA-binding protein HU Streptococcus thermophilus
Q87E48 5.31e-18 75 38 0 93 3 hup DNA-binding protein HU Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P05385 5.65e-18 74 42 0 91 1 hup DNA-binding protein HU Clostridium pasteurianum
A1WUI6 7.21e-18 74 37 1 93 3 ihfB Integration host factor subunit beta Halorhodospira halophila (strain DSM 244 / SL1)
P43724 8.67e-18 74 40 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UF83 1.18e-17 73 40 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain PittGG)
P68574 1.78e-17 73 38 0 89 3 hup2 DNA-binding protein HU 2 Bacillus phage SPbeta
P68573 1.78e-17 73 38 0 89 3 hup2 SPbeta prophage-derived DNA-binding protein HU 2 Bacillus subtilis (strain 168)
Q21IT4 1.89e-17 73 37 1 97 3 ihfB Integration host factor subunit beta Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P19436 2.22e-17 73 38 0 91 1 TTHA1349 DNA-binding protein HU Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A5EWQ2 2.72e-17 73 39 1 91 3 ihfB Integration host factor subunit beta Dichelobacter nodosus (strain VCS1703A)
P0C0H2 2.75e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes
P0DB65 2.75e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M3 (strain SSI-1)
P0C097 2.75e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XB35 2.75e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DB64 2.75e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0H3 2.75e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M1
Q9XB22 3.06e-17 72 39 0 84 3 hup DNA-binding protein HU Streptococcus downei
C5BSK5 3.84e-17 72 37 1 93 3 ihfB Integration host factor subunit beta Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q9KV83 3.88e-17 72 41 0 86 3 hupA DNA-binding protein HU-alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B0UUH4 4.54e-17 72 40 1 90 3 ihfB Integration host factor subunit beta Histophilus somni (strain 2336)
Q0I390 4.54e-17 72 40 1 90 3 ihfB Integration host factor subunit beta Histophilus somni (strain 129Pt)
P52681 7.79e-17 72 38 0 89 3 hupB DNA-binding protein HU-beta Serratia marcescens
Q9JR30 8.26e-17 72 40 0 89 3 hupB2 DNA-binding protein HU-beta 2 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9PE38 8.74e-17 72 37 0 93 3 hup DNA-binding protein HU Xylella fastidiosa (strain 9a5c)
Q608S8 1.03e-16 71 38 1 90 3 ihfB Integration host factor subunit beta Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P28080 1.12e-16 71 41 0 90 3 hupA DNA-binding protein HU-alpha Vibrio proteolyticus
Q482G2 1.53e-16 71 37 1 94 3 ihfB Integration host factor subunit beta Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C3LNL8 3.03e-16 70 37 1 90 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain M66-2)
Q9KQT4 3.03e-16 70 37 1 90 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6Y4 3.03e-16 70 37 1 90 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0A1R8 4.13e-16 70 37 0 86 3 hupB DNA-binding protein HU-beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R9 4.13e-16 70 37 0 86 3 hupB DNA-binding protein HU-beta Salmonella typhi
Q9LA96 4.56e-16 70 38 0 90 3 hupA DNA-binding protein HU-alpha Aeromonas hydrophila
A7MUP0 4.89e-16 70 36 1 90 3 ihfB Integration host factor subunit beta Vibrio campbellii (strain ATCC BAA-1116)
Q87N46 5.03e-16 70 36 1 90 3 ihfB Integration host factor subunit beta Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q2SCF7 5.18e-16 70 37 1 93 3 ihfB Integration host factor subunit beta Hahella chejuensis (strain KCTC 2396)
Q7MLX5 5.43e-16 69 36 1 91 3 ihfB Integration host factor subunit beta Vibrio vulnificus (strain YJ016)
P02344 6.67e-16 69 39 0 89 1 hupB DNA-binding protein HRm Rhizobium meliloti (strain 1021)
Q8D8J3 6.97e-16 69 36 1 90 3 ihfB Integration host factor subunit beta Vibrio vulnificus (strain CMCP6)
B7VH32 7.31e-16 69 36 1 90 3 ihfB Integration host factor subunit beta Vibrio atlanticus (strain LGP32)
A1TZF1 8.18e-16 69 36 1 96 3 ihfB Integration host factor subunit beta Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
P0ACF7 1.43e-15 68 35 0 89 3 hupB DNA-binding protein HU-beta Shigella flexneri
P0ACF4 1.43e-15 68 35 0 89 1 hupB DNA-binding protein HU-beta Escherichia coli (strain K12)
P0ACF5 1.43e-15 68 35 0 89 3 hupB DNA-binding protein HU-beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACF6 1.43e-15 68 35 0 89 3 hupB DNA-binding protein HU-beta Escherichia coli O157:H7
B8F475 1.65e-15 68 38 1 91 3 ihfB Integration host factor subunit beta Glaesserella parasuis serovar 5 (strain SH0165)
B5FG57 1.68e-15 68 37 1 93 3 ihfB Integration host factor subunit beta Aliivibrio fischeri (strain MJ11)
Q5E3Z3 1.68e-15 68 37 1 93 3 ihfB Integration host factor subunit beta Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q89B22 1.7e-15 68 34 0 90 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A6W0A0 1.78e-15 68 37 1 90 3 ihfB Integration host factor subunit beta Marinomonas sp. (strain MWYL1)
Q9CI64 1.95e-15 68 41 0 84 1 hup DNA-binding protein HU Lactococcus lactis subsp. lactis (strain IL1403)
P02348 2.08e-15 68 38 0 89 1 None DNA-binding protein HRL53 Rhizobium leguminosarum
A0KJ94 2.27e-15 68 32 1 90 3 ihfB Integration host factor subunit beta Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q15T07 2.52e-15 68 35 1 90 3 ihfB Integration host factor subunit beta Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A4SLS6 2.53e-15 68 32 1 90 3 ihfB Integration host factor subunit beta Aeromonas salmonicida (strain A449)
P52680 3.06e-15 67 37 0 90 3 hupA DNA-binding protein HU-alpha Serratia marcescens
P0ACF3 3.61e-15 67 38 0 89 3 hupA DNA-binding protein HU-alpha Shigella flexneri
E0J6W8 3.61e-15 67 38 0 89 1 hupA DNA-binding protein HU-alpha Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)
P0ACF0 3.61e-15 67 38 0 89 1 hupA DNA-binding protein HU-alpha Escherichia coli (strain K12)
P0ACF1 3.61e-15 67 38 0 89 3 hupA DNA-binding protein HU-alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACF2 3.61e-15 67 38 0 89 3 hupA DNA-binding protein HU-alpha Escherichia coli O157:H7
A1S6D6 4.37e-15 67 35 1 91 3 ihfB Integration host factor subunit beta Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q82TD7 4.82e-15 67 35 2 97 3 ihfB Integration host factor subunit beta Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B6EIY1 5.17e-15 67 37 1 90 3 ihfB Integration host factor subunit beta Aliivibrio salmonicida (strain LFI1238)
Q1QVK5 5.73e-15 67 34 1 93 3 ihfB Integration host factor subunit beta Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9CK94 6.02e-15 67 36 0 90 3 hup DNA-binding protein HU Pasteurella multocida (strain Pm70)
Q0AIZ2 6.06e-15 67 34 1 93 3 ihfB Integration host factor subunit beta Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q0AA51 6.65e-15 67 35 1 90 3 ihfB Integration host factor subunit beta Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q081U7 1.02e-14 66 32 1 95 3 ihfB Integration host factor subunit beta Shewanella frigidimarina (strain NCIMB 400)
B8GX11 1.06e-14 66 38 0 88 3 hup DNA-binding protein HU Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAV2 1.06e-14 66 38 0 88 3 hup DNA-binding protein HU Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8P8P6 1.06e-14 67 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RSA5 1.06e-14 67 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain B100)
Q4UVD5 1.06e-14 67 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain 8004)
Q8PK78 1.13e-14 66 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas axonopodis pv. citri (strain 306)
B2SLH4 1.22e-14 66 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P3S1 1.22e-14 66 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
P64389 1.27e-14 66 37 0 86 3 hupB DNA-binding protein HU-beta Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64388 1.27e-14 66 37 0 86 3 hupB DNA-binding protein HU-beta Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q0BQI4 1.28e-14 66 34 1 96 3 ihfB Integration host factor subunit beta Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
P0A1R6 1.35e-14 66 36 0 90 3 hupA DNA-binding protein HU-alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R7 1.35e-14 66 36 0 90 3 hupA DNA-binding protein HU-alpha Salmonella typhi
C4LF00 1.44e-14 66 36 1 90 3 ihfB Integration host factor subunit beta Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B0BP19 1.53e-14 66 40 1 91 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXH5 1.53e-14 66 40 1 91 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0A3 1.53e-14 66 40 1 91 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q89WE8 1.64e-14 66 30 1 95 3 ihfB Integration host factor subunit beta Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A1RJG1 2.21e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain W3-18-1)
A4Y729 2.21e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
P43722 2.3e-14 65 36 0 86 3 hup DNA-binding protein HU Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B6JCN9 2.34e-14 65 31 1 92 3 ihfB Integration host factor subunit beta Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q07UH4 2.36e-14 65 31 1 92 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisA53)
A9H0B5 2.46e-14 65 34 1 97 3 ihfB Integration host factor subunit beta Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q87BJ8 2.48e-14 65 35 1 95 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6X0 2.48e-14 65 35 1 95 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain M23)
Q9CML8 2.54e-14 65 34 1 91 3 ihfB Integration host factor subunit beta Pasteurella multocida (strain Pm70)
Q6LPE4 2.97e-14 65 34 1 90 3 ihfB Integration host factor subunit beta Photobacterium profundum (strain SS9)
Q0HV14 3.13e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain MR-7)
Q0HIW8 3.13e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain MR-4)
A0KWP0 3.13e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain ANA-3)
Q8EEI1 3.13e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q3IL99 3.13e-14 65 33 1 93 3 ihfB Integration host factor subunit beta Pseudoalteromonas translucida (strain TAC 125)
Q65SH8 3.19e-14 65 35 1 91 3 ihfB Integration host factor subunit beta Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C5BBR9 3.37e-14 65 36 1 87 3 ihfB Integration host factor subunit beta Edwardsiella ictaluri (strain 93-146)
Q9HTL0 3.4e-14 65 34 0 89 3 hupA DNA-binding protein HU-alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A9L2X4 3.65e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS195)
A6WNM7 3.65e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS185)
A3D4A9 3.65e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EA98 3.65e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS223)
B8GRS4 3.86e-14 65 35 1 90 3 ihfB Integration host factor subunit beta Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q9PAQ8 4e-14 65 35 1 95 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain 9a5c)
A3QEC3 4.11e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q12ND8 4.24e-14 65 32 1 91 3 ihfB Integration host factor subunit beta Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B2FNP6 4.28e-14 65 36 1 95 3 ihfB Integration host factor subunit beta Stenotrophomonas maltophilia (strain K279a)
B4SSV3 4.28e-14 65 36 1 95 3 ihfB Integration host factor subunit beta Stenotrophomonas maltophilia (strain R551-3)
P57144 4.49e-14 65 36 0 91 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P95519 4.5e-14 65 37 1 91 3 ihfB Integration host factor subunit beta Mannheimia haemolytica
A1KUD0 4.91e-14 65 34 1 96 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0U2 4.91e-14 65 34 1 96 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0U1 4.91e-14 65 34 1 96 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A0U3 4.91e-14 65 34 1 96 3 ihfB Integration host factor subunit beta Neisseria gonorrhoeae
A5E8A7 5.4e-14 65 29 1 95 3 ihfB Integration host factor subunit beta Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4YJI9 5.49e-14 65 29 1 96 3 ihfB Integration host factor subunit beta Bradyrhizobium sp. (strain ORS 278)
B1KF50 6.14e-14 64 32 1 91 3 ihfB Integration host factor subunit beta Shewanella woodyi (strain ATCC 51908 / MS32)
A9IL25 6.36e-14 64 31 1 92 3 ihfB Integration host factor subunit beta Bartonella tribocorum (strain CIP 105476 / IBS 506)
A8LSF5 6.56e-14 64 37 0 74 3 ihfB Integration host factor subunit beta Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A6VPK8 7.05e-14 64 37 1 91 3 ihfB Integration host factor subunit beta Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q1QS30 7.44e-14 64 30 1 92 3 ihfB Integration host factor subunit beta Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q3SWL5 8.38e-14 64 30 1 92 3 ihfB Integration host factor subunit beta Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A8FVN3 8.51e-14 64 31 1 91 3 ihfB Integration host factor subunit beta Shewanella sediminis (strain HAW-EB3)
A8H4A7 8.99e-14 64 32 1 91 3 ihfB Integration host factor subunit beta Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
O83278 9.14e-14 64 37 0 88 3 hup DNA-binding protein HU Treponema pallidum (strain Nichols)
A4VMF7 1.02e-13 63 33 1 90 3 ihfB Integration host factor subunit beta Stutzerimonas stutzeri (strain A1501)
Q21CB6 1.06e-13 64 29 1 94 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisB18)
Q51473 1.11e-13 63 33 1 90 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PW7 1.11e-13 63 33 1 90 1 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VAL8 1.11e-13 63 33 1 90 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain LESB58)
A6V2R4 1.11e-13 63 33 1 90 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain PA7)
Q44654 1.17e-13 63 35 1 87 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P05514 1.18e-13 63 34 0 89 1 hup DNA-binding protein HU Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8KA69 1.38e-13 63 34 0 90 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B0TT46 1.55e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Shewanella halifaxensis (strain HAW-EB4)
B8D7K1 1.61e-13 63 34 1 87 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57394 1.61e-13 63 34 1 87 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D999 1.61e-13 63 34 1 87 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A9MHX0 1.84e-13 63 34 1 87 3 ihfB Integration host factor subunit beta Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5XY84 1.84e-13 63 34 1 87 3 ihfB Integration host factor subunit beta Klebsiella pneumoniae (strain 342)
Q2J2G1 1.93e-13 63 29 1 94 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain HaA2)
A6T704 2.01e-13 63 34 1 87 3 ihfB Integration host factor subunit beta Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7IHH0 2.21e-13 63 31 1 90 3 ihfB Integration host factor subunit beta Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q9ZDZ2 2.21e-13 63 42 0 71 3 hup DNA-binding protein HU Rickettsia prowazekii (strain Madrid E)
Q2RXP8 2.24e-13 63 34 1 87 3 ihfB Integration host factor subunit beta Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q7N6D2 2.31e-13 63 33 1 90 3 ihfB Integration host factor subunit beta Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6T1G0 2.32e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Janthinobacterium sp. (strain Marseille)
A4G858 2.32e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Herminiimonas arsenicoxydans
Q5QZ46 2.4e-13 63 34 0 90 3 ihfB Integration host factor subunit beta Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0ATJ4 2.62e-13 63 34 1 93 3 ihfB Integration host factor subunit beta Maricaulis maris (strain MCS10)
C1DRR5 2.64e-13 62 32 1 90 3 ihfB Integration host factor subunit beta Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4W8T1 2.69e-13 63 34 1 87 3 ihfB Integration host factor subunit beta Enterobacter sp. (strain 638)
A4XTF3 2.72e-13 63 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas mendocina (strain ymp)
P05384 2.74e-13 62 33 0 86 1 hupB DNA-binding protein HU-beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q28LB0 2.81e-13 63 35 1 90 3 ihfB Integration host factor subunit beta Jannaschia sp. (strain CCS1)
P29214 2.95e-13 62 32 0 92 3 hup DNA-binding protein HU homolog Guillardia theta
Q47GJ8 3.03e-13 62 31 1 94 3 ihfB Integration host factor subunit beta Dechloromonas aromatica (strain RCB)
B6IUP4 3.22e-13 62 33 1 90 3 ihfB Integration host factor subunit beta Rhodospirillum centenum (strain ATCC 51521 / SW)
P0A129 3.9e-13 62 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida
P0A128 3.9e-13 62 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KTY3 4.19e-13 62 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain GB-1)
A5W7F5 4.19e-13 62 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q3Z3K9 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Shigella sonnei (strain Ss046)
P0A6Y4 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Shigella flexneri
Q0SX03 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Shigella flexneri serotype 5b (strain 8401)
Q32E32 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Shigella dysenteriae serotype 1 (strain Sd197)
Q31YT8 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Shigella boydii serotype 4 (strain Sb227)
B2TUG9 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RDU6 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain UTI89 / UPEC)
B1LJV1 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain SMS-3-5 / SECEC)
B6I8Y4 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain SE11)
B7NAR1 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6Y1 4.47e-13 62 33 1 87 1 ihfB Integration host factor subunit beta Escherichia coli (strain K12)
B1IW19 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6Y2 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJE1 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZYL5 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O9:H4 (strain HS)
B1X852 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain K12 / DH10B)
C4ZQ38 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain K12 / MC4100 / BW2952)
B7M841 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O8 (strain IAI1)
B7MS27 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O81 (strain ED1a)
B7NM62 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT46 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6Y3 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O157:H7
B7LDA4 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain 55989 / EAEC)
B7MHM1 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZK01 4.47e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3K8V7 4.77e-13 62 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas fluorescens (strain Pf0-1)
P64394 4.77e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64395 4.77e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Salmonella typhi
B4TRU3 4.77e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Salmonella schwarzengrund (strain CVM19633)
B5BBP5 4.77e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Salmonella paratyphi A (strain AKU_12601)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_09025
Feature type CDS
Gene ihfA
Product integration host factor subunit alpha
Location 217699 - 217995 (strand: 1)
Length 297 (nucleotides) / 98 (amino acids)
In genomic island -

Contig

Accession ZDB_523
Length 257158 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1842
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00216 Bacterial DNA-binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0776 Replication, recombination and repair (L) L Bacterial nucleoid DNA-binding protein IHF-alpha

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04764 integration host factor subunit alpha - -

Protein Sequence

MALTKAEMSENLSEKLDLSKRDAKDLVELFFEEVRRSLENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKAKVEKSTPKE

Flanking regions ( +/- flanking 50bp)

CGTTGCCGCGTTGCAACAGCGATTTAAAGCATCCTTGAGGGACTAAACCTATGGCGCTTACTAAAGCTGAAATGTCAGAAAATCTGTCGGAAAAACTGGACCTGAGCAAACGCGATGCGAAGGACCTGGTTGAACTGTTTTTTGAAGAGGTACGCCGTTCTCTTGAGAATGGTGAGCAGGTAAAATTATCCGGTTTCGGAAACTTTGATCTGCGGGACAAGAATCAGCGTCCGGGCCGTAACCCGAAAACGGGTGAAGATATTCCTATCACAGCCCGTCGTGTTGTCACTTTCCGTCCGGGGCAGAAACTGAAAGCCAAGGTCGAAAAATCGACACCGAAAGAGTAAGACCTGAAACGACCTCTTATGAGGTCGTTTTCTTTTCTGTGGTTTGTCAG