Homologs in group_1805

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13395 FBDBKF_13395 99.0 Morganella morganii S1 ihfA integration host factor subunit alpha
EHELCC_08700 EHELCC_08700 99.0 Morganella morganii S2 ihfA integration host factor subunit alpha
NLDBIP_09025 NLDBIP_09025 99.0 Morganella morganii S4 ihfA integration host factor subunit alpha
LHKJJB_05240 LHKJJB_05240 99.0 Morganella morganii S3 ihfA integration host factor subunit alpha
HKOGLL_05675 HKOGLL_05675 99.0 Morganella morganii S5 ihfA integration host factor subunit alpha
PMI_RS05055 PMI_RS05055 89.8 Proteus mirabilis HI4320 ihfA integration host factor subunit alpha

Distribution of the homologs in the orthogroup group_1805

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1805

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N3Q2 3.76e-61 184 92 0 98 3 ihfA Integration host factor subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JJ23 7.95e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q9X9F6 7.95e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIL7 7.95e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Yersinia pestis (strain Pestoides F)
Q1CIH0 7.95e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0A2 7.95e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX2 7.95e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Yersinia pestis
B2K662 7.95e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C735 7.95e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHG7 7.95e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JMM4 7.95e-60 181 90 0 98 3 ihfA Integration host factor subunit alpha Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GDR1 3e-59 179 89 0 98 3 ihfA Integration host factor subunit alpha Serratia proteamaculans (strain 568)
B4ETL2 4.6e-59 179 89 0 98 3 ihfA Integration host factor subunit alpha Proteus mirabilis (strain HI4320)
C5B852 5.61e-59 178 88 0 98 3 ihfA Integration host factor subunit alpha Edwardsiella ictaluri (strain 93-146)
B2VEL2 1.49e-58 177 89 0 98 3 ihfA Integration host factor subunit alpha Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P23302 1.64e-58 177 89 0 97 3 ihfA Integration host factor subunit alpha Serratia marcescens
P37982 3.14e-58 176 88 0 98 3 ihfA Integration host factor subunit alpha Dickeya dadantii (strain 3937)
C6DFZ2 3.91e-58 176 88 0 98 3 ihfA Integration host factor subunit alpha Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4H4 3.91e-58 176 88 0 98 3 ihfA Integration host factor subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NT26 7.4e-58 176 87 0 98 3 ihfA Integration host factor subunit alpha Sodalis glossinidius (strain morsitans)
P0A1S0 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1S1 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella typhi
B4TUF6 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella schwarzengrund (strain CVM19633)
B5BA36 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella paratyphi A (strain AKU_12601)
C0Q640 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella paratyphi C (strain RKS4594)
A9N236 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PH86 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4N4 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella newport (strain SL254)
B4TGH7 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella heidelberg (strain SL476)
B5RAW7 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW2 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella enteritidis PT4 (strain P125109)
B5FJA2 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella dublin (strain CT_02021853)
Q57PU7 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella choleraesuis (strain SC-B67)
B5F7F6 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella agona (strain SL483)
A8AHA5 2.21e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MNY7 2.64e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
A4W9M9 2.85e-57 174 87 0 97 3 ihfA Integration host factor subunit alpha Enterobacter sp. (strain 638)
A9MFB7 3.36e-57 174 86 0 98 3 ihfA Integration host factor subunit alpha Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TAI1 7.49e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XQD2 7.49e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Klebsiella pneumoniae (strain 342)
Q3Z260 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Shigella sonnei (strain Ss046)
P0A6Y0 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Shigella flexneri
Q0T4S2 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Shigella flexneri serotype 5b (strain 8401)
Q32FI7 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Shigella dysenteriae serotype 1 (strain Sd197)
Q321K4 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Shigella boydii serotype 4 (strain Sb227)
B2U390 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LQ77 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RB83 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain UTI89 / UPEC)
B1LE18 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain SMS-3-5 / SECEC)
B6I8Q5 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain SE11)
B7N550 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6X7 8.83e-57 173 85 0 98 1 ihfA Integration host factor subunit alpha Escherichia coli (strain K12)
B1IPL5 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6X8 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THB6 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1XG19 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain K12 / DH10B)
C4ZYH4 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1C1 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O8 (strain IAI1)
B7MVJ1 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O81 (strain ED1a)
B7NT64 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQ00 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6X9 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O157:H7
B7L6I5 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli (strain 55989 / EAEC)
B7MAS3 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O45:K1 (strain S88 / ExPEC)
B7US95 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZMI0 8.83e-57 173 85 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O139:H28 (strain E24377A / ETEC)
A8A0Q4 4.73e-56 171 84 0 98 3 ihfA Integration host factor subunit alpha Escherichia coli O9:H4 (strain HS)
Q7MK44 7.79e-53 163 84 0 92 3 ihfA Integration host factor subunit alpha Vibrio vulnificus (strain YJ016)
Q8DA35 7.79e-53 163 84 0 92 3 ihfA Integration host factor subunit alpha Vibrio vulnificus (strain CMCP6)
B4RS41 2.19e-52 162 81 0 96 3 ihfA Integration host factor subunit alpha Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A3QF32 3.08e-52 161 80 0 94 3 ihfA Integration host factor subunit alpha Shewanella loihica (strain ATCC BAA-1088 / PV-4)
C3LLR8 4.43e-52 161 83 0 92 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain M66-2)
Q9KSN4 4.43e-52 161 83 0 92 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1W7 4.43e-52 161 83 0 92 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VPF6 4.53e-52 161 83 0 92 3 ihfA Integration host factor subunit alpha Vibrio atlanticus (strain LGP32)
B1KRE5 4.74e-52 161 78 0 97 3 ihfA Integration host factor subunit alpha Shewanella woodyi (strain ATCC 51908 / MS32)
A8FWI0 5.4e-52 160 78 0 97 3 ihfA Integration host factor subunit alpha Shewanella sediminis (strain HAW-EB3)
B8CR59 5.4e-52 160 78 0 97 3 ihfA Integration host factor subunit alpha Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H5F1 5.4e-52 160 78 0 97 3 ihfA Integration host factor subunit alpha Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TQY4 5.4e-52 160 78 0 97 3 ihfA Integration host factor subunit alpha Shewanella halifaxensis (strain HAW-EB4)
Q12NT8 9.22e-52 160 81 0 94 3 ihfA Integration host factor subunit alpha Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1S700 1.33e-51 160 80 0 94 3 ihfA Integration host factor subunit alpha Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A7MVH4 1.93e-51 159 82 0 92 3 ihfA Integration host factor subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
Q87Q56 2.01e-51 159 82 0 92 3 ihfA Integration host factor subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q15SX9 5.01e-51 158 78 0 98 3 ihfA Integration host factor subunit alpha Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q083K5 6.57e-51 158 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella frigidimarina (strain NCIMB 400)
Q0HUQ0 7.35e-51 158 80 0 94 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain MR-7)
Q0HJ83 7.35e-51 158 80 0 94 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain MR-4)
A1RK12 1.64e-50 157 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain W3-18-1)
A4Y6H0 1.64e-50 157 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KYZ2 1.64e-50 157 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS195)
A6WMK6 1.64e-50 157 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS185)
A3D3R8 1.64e-50 157 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E7F3 1.64e-50 157 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS223)
Q8EF98 1.79e-50 157 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0KWC7 1.81e-50 157 79 0 94 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain ANA-3)
A0KKP3 2.11e-50 157 75 0 98 3 ihfA Integration host factor subunit alpha Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B8GRI6 8.38e-50 155 82 0 92 3 ihfA Integration host factor subunit alpha Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A4VM16 1.05e-49 155 82 0 91 3 ihfA Integration host factor subunit alpha Stutzerimonas stutzeri (strain A1501)
Q4ZUG1 1.71e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas syringae pv. syringae (strain B728a)
Q883H6 1.71e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KEX6 1.71e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain Pf0-1)
C3JZN1 1.71e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain SBW25)
Q4KEV8 1.71e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48JR7 1.71e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1IC09 2.22e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas entomophila (strain L48)
B1J6V0 3.09e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain W619)
P0A127 3.09e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas putida
P0A126 3.09e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KKR2 3.09e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain GB-1)
A5W5D5 3.09e-49 154 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q3IIL3 3.69e-49 154 75 0 97 3 ihfA Integration host factor subunit alpha Pseudoalteromonas translucida (strain TAC 125)
Q51472 4.06e-49 154 81 0 91 1 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NN5 4.06e-49 154 81 0 91 1 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V491 4.06e-49 154 81 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain PA7)
A4XTS7 5.89e-49 153 82 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas mendocina (strain ymp)
B7V312 8.28e-49 153 81 0 91 3 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain LESB58)
Q47ZS6 4.99e-48 150 77 0 92 3 ihfA Integration host factor subunit alpha Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C4LFG7 1.03e-47 150 73 0 96 3 ihfA Integration host factor subunit alpha Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B5FDX6 1.26e-47 150 76 0 92 3 ihfA Integration host factor subunit alpha Aliivibrio fischeri (strain MJ11)
Q5E5G4 1.26e-47 150 76 0 92 3 ihfA Integration host factor subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EN06 1.32e-47 150 76 0 92 3 ihfA Integration host factor subunit alpha Aliivibrio salmonicida (strain LFI1238)
Q3JBZ6 7.62e-47 148 75 0 92 3 ihfA Integration host factor subunit alpha Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q21KD4 1.18e-46 147 78 0 91 3 ihfA Integration host factor subunit alpha Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1WU59 1.47e-46 147 76 0 92 3 ihfA Integration host factor subunit alpha Halorhodospira halophila (strain DSM 244 / SL1)
Q0AAM1 4.79e-46 146 76 0 92 3 ihfA Integration host factor subunit alpha Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2SDJ8 5.02e-46 145 76 0 91 3 ihfA Integration host factor subunit alpha Hahella chejuensis (strain KCTC 2396)
Q9CN18 7.32e-46 145 70 0 97 3 ihfA Integration host factor subunit alpha Pasteurella multocida (strain Pm70)
A1U2B7 2e-45 144 75 0 91 3 ihfA Integration host factor subunit alpha Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q83C16 5.62e-45 143 72 1 99 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N8J9 5.62e-45 143 72 1 99 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KGB5 5.62e-45 143 72 1 99 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain Dugway 5J108-111)
B6IZG2 5.62e-45 143 72 1 99 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain CbuG_Q212)
B6J7X5 5.62e-45 143 72 1 99 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain CbuK_Q154)
Q0VNG4 9.91e-45 142 75 0 91 3 ihfA Integration host factor subunit alpha Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5QXL9 1.04e-44 142 70 0 98 3 ihfA Integration host factor subunit alpha Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q057Y8 2e-44 142 73 0 92 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A6VP80 2.37e-44 141 68 0 97 3 ihfA Integration host factor subunit alpha Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q1QWK1 4.73e-44 141 73 0 91 3 ihfA Integration host factor subunit alpha Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1SUQ7 6.61e-44 140 69 0 96 3 ihfA Integration host factor subunit alpha Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q60AY8 6.59e-43 138 75 0 92 3 ihfA Integration host factor subunit alpha Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A6VYH5 2.01e-42 137 72 0 91 3 ihfA Integration host factor subunit alpha Marinomonas sp. (strain MWYL1)
B2FN73 2.64e-42 136 71 0 92 3 ihfA Integration host factor subunit alpha Stenotrophomonas maltophilia (strain K279a)
B4SQG8 2.64e-42 136 71 0 92 3 ihfA Integration host factor subunit alpha Stenotrophomonas maltophilia (strain R551-3)
Q5GXY6 6.01e-42 135 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P101 6.01e-42 135 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BRU3 6.01e-42 135 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P0A0T9 6.01e-42 135 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RRH5 6.01e-42 135 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain B100)
Q4UW51 6.01e-42 135 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain 8004)
P0A0U0 6.01e-42 135 71 0 92 3 ihfA Integration host factor subunit alpha Xanthomonas axonopodis pv. citri (strain 306)
Q2YBS0 1.97e-41 134 70 0 94 3 ihfA Integration host factor subunit alpha Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1GZS3 3.35e-41 134 67 0 94 3 ihfA Integration host factor subunit alpha Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5P7Y1 4.32e-41 133 70 0 93 3 ihfA Integration host factor subunit alpha Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q65TL4 8.19e-41 132 64 0 97 3 ihfA Integration host factor subunit alpha Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UU60 8.59e-41 132 68 1 97 3 ihfA Integration host factor subunit alpha Histophilus somni (strain 2336)
Q0I3K4 8.59e-41 132 68 1 97 3 ihfA Integration host factor subunit alpha Histophilus somni (strain 129Pt)
Q5ZS10 1.31e-40 132 69 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WT88 1.32e-40 132 69 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Lens)
A5IAL5 1.32e-40 132 69 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Corby)
Q5X1H9 1.32e-40 132 69 0 92 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Paris)
Q7NYC0 1.39e-40 132 68 0 93 3 ihfA Integration host factor subunit alpha Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B0V5Q4 1.77e-40 132 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AYE)
A3M2B0 1.77e-40 132 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VV83 1.77e-40 132 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain SDF)
B2HTI2 1.77e-40 132 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain ACICU)
B7I698 1.77e-40 132 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AB0057)
B7GZZ4 1.77e-40 132 67 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AB307-0294)
A1K4E7 2.31e-40 131 69 0 93 3 ihfA Integration host factor subunit alpha Azoarcus sp. (strain BH72)
Q6F874 4.8e-40 130 66 0 90 3 ihfA Integration host factor subunit alpha Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q47CN0 4.97e-40 130 69 0 92 3 ihfA2 Integration host factor subunit alpha 2 Dechloromonas aromatica (strain RCB)
Q63TM8 6.92e-40 130 72 0 90 3 ihfA Integration host factor subunit alpha Burkholderia pseudomallei (strain K96243)
Q82VV7 9.44e-40 130 67 0 92 3 ihfA Integration host factor subunit alpha Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0ADP0 1.28e-39 129 67 0 92 3 ihfA Integration host factor subunit alpha Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q31F20 1.95e-39 129 61 0 92 3 ihfA Integration host factor subunit alpha Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A1KSZ1 3.42e-39 129 61 1 99 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P64393 3.42e-39 129 61 1 99 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64392 3.42e-39 129 61 1 99 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M383 3.42e-39 129 61 1 99 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup C (strain 053442)
P43723 6.48e-39 127 63 0 93 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKM2 6.48e-39 127 63 0 93 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain 86-028NP)
B4RJZ4 6.83e-39 128 61 1 99 3 ihfA Integration host factor subunit alpha Neisseria gonorrhoeae (strain NCCP11945)
Q5F9T5 6.83e-39 128 61 1 99 3 ihfA Integration host factor subunit alpha Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9PFD5 6.85e-39 127 67 0 92 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain 9a5c)
Q8XZ23 6.9e-39 128 69 0 91 3 ihfA Integration host factor subunit alpha Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q87AB7 2.05e-38 126 66 0 92 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5D7 2.05e-38 126 66 0 92 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain M12)
B2I9P2 2.05e-38 126 66 0 92 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain M23)
A5EXT4 2.2e-38 126 60 0 97 3 ihfA Integration host factor subunit alpha Dichelobacter nodosus (strain VCS1703A)
A5UF06 2.47e-38 126 63 0 93 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain PittGG)
Q9F297 5.87e-38 125 62 1 94 3 ihfA Integration host factor subunit alpha (Fragment) Neisseria gonorrhoeae
Q2KZM3 3.18e-37 124 66 0 92 3 ihfA Integration host factor subunit alpha Bordetella avium (strain 197N)
Q3SK28 1.15e-36 122 65 0 90 3 ihfA Integration host factor subunit alpha Thiobacillus denitrificans (strain ATCC 25259)
Q7W7C5 2.11e-36 122 64 0 93 3 ihfA Integration host factor subunit alpha Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKR3 2.11e-36 122 64 0 93 3 ihfA Integration host factor subunit alpha Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VVR6 2.9e-36 121 65 0 91 3 ihfA Integration host factor subunit alpha Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P95516 1.52e-34 117 63 0 97 3 ihfA Integration host factor subunit alpha Mannheimia haemolytica
B8F4T7 7.3e-34 115 65 0 97 3 ihfA Integration host factor subunit alpha Glaesserella parasuis serovar 5 (strain SH0165)
Q47GF4 1.11e-33 115 56 0 94 3 ihfA1 Integration host factor subunit alpha 1 Dechloromonas aromatica (strain RCB)
Q8KA11 2.02e-32 111 68 0 92 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q4FQ67 2.56e-32 111 55 0 92 3 ihfA Integration host factor subunit alpha Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1Q8C9 2.98e-32 111 55 0 92 3 ihfA Integration host factor subunit alpha Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q21YS7 3.63e-32 111 59 0 91 3 ihfA Integration host factor subunit alpha Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B0BNN9 7.67e-32 110 67 0 92 3 ihfA Integration host factor subunit alpha Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H139 7.67e-32 110 67 0 92 3 ihfA Integration host factor subunit alpha Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZX6 7.67e-32 110 67 0 92 3 ihfA Integration host factor subunit alpha Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A5UCA8 1.66e-31 109 62 0 93 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain PittEE)
A9C3C8 1.78e-31 109 55 0 94 3 ihfA Integration host factor subunit alpha Delftia acidovorans (strain DSM 14801 / SPH-1)
Q6MMJ0 1.03e-30 107 56 0 87 3 ihfA Integration host factor subunit alpha Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B8D736 1.06e-30 107 67 0 91 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57231 1.06e-30 107 67 0 91 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8T2 1.06e-30 107 67 0 91 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q12BQ7 1.21e-30 107 54 0 91 3 ihfA Integration host factor subunit alpha Polaromonas sp. (strain JS666 / ATCC BAA-500)
B4UAP1 1.34e-29 105 53 0 86 3 ihfA Integration host factor subunit alpha Anaeromyxobacter sp. (strain K)
B8J836 1.34e-29 105 53 0 86 3 ihfA Integration host factor subunit alpha Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IJA7 1.46e-29 104 53 0 86 3 ihfA Integration host factor subunit alpha Anaeromyxobacter dehalogenans (strain 2CP-C)
A1VR71 5.13e-29 103 52 0 94 3 ihfA Integration host factor subunit alpha Polaromonas naphthalenivorans (strain CJ2)
A7HBJ3 6.35e-29 102 52 0 86 3 ihfA Integration host factor subunit alpha Anaeromyxobacter sp. (strain Fw109-5)
Q7VLG4 1.16e-27 99 58 0 92 3 ihfA Integration host factor subunit alpha Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q1D6D8 2.51e-27 99 46 0 96 3 ihfA Integration host factor subunit alpha Myxococcus xanthus (strain DK1622)
Q9K4Q3 2.51e-27 99 46 0 96 3 ihfA Integration host factor subunit alpha Myxococcus xanthus
Q2W4R6 1.65e-26 97 48 0 89 3 ihfA Integration host factor subunit alpha Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2RTS7 1.57e-25 94 46 0 89 3 ihfA Integration host factor subunit alpha Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2N927 2.21e-25 94 46 0 92 3 ihfA Integration host factor subunit alpha Erythrobacter litoralis (strain HTCC2594)
B4RB18 6.18e-25 92 46 0 95 3 ihfA Integration host factor subunit alpha Phenylobacterium zucineum (strain HLK1)
A8I5K8 1.35e-24 92 45 0 95 3 ihfA Integration host factor subunit alpha Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A5VC87 1.48e-24 91 48 0 89 3 ihfA Integration host factor subunit alpha Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q0APH3 1.79e-24 91 45 0 96 3 ihfA Integration host factor subunit alpha Maricaulis maris (strain MCS10)
A1B366 1.95e-24 91 47 0 89 3 ihfA Integration host factor subunit alpha Paracoccus denitrificans (strain Pd 1222)
Q1GT91 2.02e-24 91 44 0 89 3 ihfA Integration host factor subunit alpha Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q9RNZ5 2.22e-24 91 44 0 93 3 ihfA Integration host factor subunit alpha Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A6X1X7 5.3e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P64391 5.79e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Brucella suis biovar 1 (strain 1330)
P64390 5.79e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RIB4 5.79e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Brucella melitensis biotype 2 (strain ATCC 23457)
A9MAF7 5.79e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57DX3 5.79e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Brucella abortus biovar 1 (strain 9-941)
Q2YNB8 5.79e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Brucella abortus (strain 2308)
B2S525 5.79e-24 90 46 0 89 3 ihfA Integration host factor subunit alpha Brucella abortus (strain S19)
Q1MIS5 6.15e-24 90 44 0 92 3 ihfA Integration host factor subunit alpha Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B5ZXV9 7.65e-24 90 44 0 92 3 ihfA Integration host factor subunit alpha Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B0T0T0 8.06e-24 89 47 0 92 3 ihfA Integration host factor subunit alpha Caulobacter sp. (strain K31)
C3M9J7 9.41e-24 90 44 0 92 3 ihfA Integration host factor subunit alpha Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B9JCZ0 1.25e-23 89 43 0 92 3 ihfA Integration host factor subunit alpha Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B0CLA3 1.45e-23 89 46 0 89 3 ihfA Integration host factor subunit alpha Brucella suis (strain ATCC 23445 / NCTC 10510)
A6U7Q6 1.56e-23 89 44 0 92 3 ihfA Integration host factor subunit alpha Sinorhizobium medicae (strain WSM419)
Q92QT3 1.56e-23 89 44 0 92 3 ihfA Integration host factor subunit alpha Rhizobium meliloti (strain 1021)
Q2KA00 1.57e-23 89 43 0 92 3 ihfA Integration host factor subunit alpha Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PVE1 1.64e-23 89 43 0 92 3 ihfA Integration host factor subunit alpha Rhizobium etli (strain CIAT 652)
A4WTU0 1.77e-23 89 46 0 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3J366 1.77e-23 89 46 0 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PJ63 1.77e-23 89 46 0 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q5LQJ4 2.18e-23 89 47 0 89 3 ihfA Integration host factor subunit alpha Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q1GI70 2.35e-23 88 46 0 89 3 ihfA Integration host factor subunit alpha Ruegeria sp. (strain TM1040)
Q11J82 4.71e-23 88 42 0 89 3 ihfA Integration host factor subunit alpha Chelativorans sp. (strain BNC1)
Q8UG61 5.05e-23 88 42 0 92 3 ihfA Integration host factor subunit alpha Agrobacterium fabrum (strain C58 / ATCC 33970)
B8H546 7.49e-23 87 46 0 92 3 ihfA Integration host factor subunit alpha Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8I3 7.49e-23 87 46 0 92 3 ihfA Integration host factor subunit alpha Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A7INL3 7.53e-23 87 43 0 89 3 ihfA Integration host factor subunit alpha Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P30787 1.11e-22 87 43 0 95 1 ihfA Integration host factor subunit alpha Rhodobacter capsulatus
Q28RG2 1.12e-22 87 46 0 89 3 ihfA Integration host factor subunit alpha Jannaschia sp. (strain CCS1)
Q214G0 1.41e-22 87 43 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisB18)
Q07MS0 1.63e-22 87 43 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisA53)
Q982Z7 2.19e-22 86 43 0 92 3 ihfA Integration host factor subunit alpha Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2IWQ7 2.71e-22 86 43 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain HaA2)
B3QJM1 2.83e-22 86 43 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain TIE-1)
Q6N676 2.83e-22 86 43 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A4YW83 2.93e-22 86 43 0 89 3 ihfA Integration host factor subunit alpha Bradyrhizobium sp. (strain ORS 278)
A5EKG4 3.27e-22 86 43 0 89 3 ihfA Integration host factor subunit alpha Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q3SSS2 3.3e-22 85 43 0 89 3 ihfA Integration host factor subunit alpha Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q136S3 3.72e-22 86 43 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisB5)
Q6FZZ9 4.49e-22 85 44 0 92 3 ihfA Integration host factor subunit alpha Bartonella quintana (strain Toulouse)
Q1QMY9 5.39e-22 85 43 0 89 3 ihfA Integration host factor subunit alpha Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A8LLT5 6e-22 85 44 0 89 3 ihfA Integration host factor subunit alpha Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B0UR46 6.02e-22 85 43 0 89 3 ihfA Integration host factor subunit alpha Methylobacterium sp. (strain 4-46)
B9JV88 6.42e-22 85 41 0 92 3 ihfA Integration host factor subunit alpha Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B6JGR8 8.24e-22 85 42 0 89 3 ihfA Integration host factor subunit alpha Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B1LZ99 2.14e-21 84 43 0 89 3 ihfA Integration host factor subunit alpha Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A9IVB2 2.17e-21 84 44 0 89 3 ihfA Integration host factor subunit alpha Bartonella tribocorum (strain CIP 105476 / IBS 506)
P08821 2.34e-21 83 42 0 89 1 hbs DNA-binding protein HU 1 Bacillus subtilis (strain 168)
Q6G3K3 2.86e-21 83 44 0 89 3 ihfA Integration host factor subunit alpha Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
P0A3H0 1.18e-20 81 42 0 90 1 hup DNA-binding protein HU Geobacillus stearothermophilus
P0A3H1 1.18e-20 81 42 0 90 1 hup DNA-binding protein HU Bacillus caldolyticus
P0A3H2 1.18e-20 81 42 0 90 3 hup DNA-binding protein HU Bacillus caldotenax
A9W4E5 1.35e-20 82 42 0 89 3 ihfA Integration host factor subunit alpha Methylorubrum extorquens (strain PA1)
B7KYG6 1.35e-20 82 42 0 89 3 ihfA Integration host factor subunit alpha Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A1USJ0 1.91e-20 81 43 0 89 3 ihfA Integration host factor subunit alpha Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B1ZKI7 2.35e-20 81 42 0 89 3 ihfA Integration host factor subunit alpha Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q7A0U9 5.94e-20 79 41 0 90 3 hup DNA-binding protein HU Staphylococcus aureus (strain MW2)
Q6G990 5.94e-20 79 41 0 90 3 hup DNA-binding protein HU Staphylococcus aureus (strain MSSA476)
Q6GGT8 5.94e-20 79 41 0 90 3 hup DNA-binding protein HU Staphylococcus aureus (strain MRSA252)
Q7A5J1 5.94e-20 79 41 0 90 1 hup DNA-binding protein HU Staphylococcus aureus (strain N315)
Q99U17 5.94e-20 79 41 0 90 1 hup DNA-binding protein HU Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFV0 5.94e-20 79 41 0 90 3 hup DNA-binding protein HU Staphylococcus aureus (strain COL)
Q9K7K5 1.09e-19 79 40 0 89 3 hup2 DNA-binding protein HU-1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KDA5 5.75e-19 77 40 0 89 3 hup1 DNA-binding protein HU-1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KQS9 6.92e-19 77 40 0 86 3 hupB DNA-binding protein HU-beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9XB21 1.15e-18 76 41 0 84 1 hup DNA-binding protein HU Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P96045 3e-18 75 40 0 84 3 hup DNA-binding protein HU Streptococcus thermophilus
Q87E48 4.36e-18 75 38 0 93 3 hup DNA-binding protein HU Xylella fastidiosa (strain Temecula1 / ATCC 700964)
A5UBN4 8.48e-18 74 40 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain PittEE)
Q4QJU8 8.48e-18 74 40 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain 86-028NP)
A1WUI6 1.23e-17 74 37 1 93 3 ihfB Integration host factor subunit beta Halorhodospira halophila (strain DSM 244 / SL1)
P19436 1.27e-17 73 38 0 91 1 TTHA1349 DNA-binding protein HU Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
B0UUH4 1.3e-17 73 40 1 90 3 ihfB Integration host factor subunit beta Histophilus somni (strain 2336)
Q0I390 1.3e-17 73 40 1 90 3 ihfB Integration host factor subunit beta Histophilus somni (strain 129Pt)
P0C0H2 1.84e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes
P0DB65 1.84e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M3 (strain SSI-1)
P0C097 1.84e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XB35 1.84e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DB64 1.84e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0H3 1.84e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M1
Q9XB22 2.05e-17 73 39 0 84 3 hup DNA-binding protein HU Streptococcus downei
P05385 3.65e-17 72 41 0 91 1 hup DNA-binding protein HU Clostridium pasteurianum
P43724 4.8e-17 72 39 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UF83 5.84e-17 72 39 1 91 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain PittGG)
Q9PE38 6.3e-17 72 37 0 93 3 hup DNA-binding protein HU Xylella fastidiosa (strain 9a5c)
Q21IT4 6.55e-17 72 37 1 97 3 ihfB Integration host factor subunit beta Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P52681 7.63e-17 72 38 0 89 3 hupB DNA-binding protein HU-beta Serratia marcescens
P68574 1.09e-16 71 37 0 89 3 hup2 DNA-binding protein HU 2 Bacillus phage SPbeta
P68573 1.09e-16 71 37 0 89 3 hup2 SPbeta prophage-derived DNA-binding protein HU 2 Bacillus subtilis (strain 168)
C5BSK5 1.13e-16 71 37 1 93 3 ihfB Integration host factor subunit beta Teredinibacter turnerae (strain ATCC 39867 / T7901)
A5EWQ2 1.6e-16 71 38 1 91 3 ihfB Integration host factor subunit beta Dichelobacter nodosus (strain VCS1703A)
Q9JR30 1.75e-16 70 40 0 89 3 hupB2 DNA-binding protein HU-beta 2 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9KV83 3.04e-16 70 40 0 86 3 hupA DNA-binding protein HU-alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A1R8 4.13e-16 70 37 0 86 3 hupB DNA-binding protein HU-beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R9 4.13e-16 70 37 0 86 3 hupB DNA-binding protein HU-beta Salmonella typhi
C3LNL8 5.71e-16 69 37 1 90 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain M66-2)
Q9KQT4 5.71e-16 69 37 1 90 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6Y4 5.71e-16 69 37 1 90 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q608S8 6.3e-16 69 37 1 90 3 ihfB Integration host factor subunit beta Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
P28080 8.95e-16 69 40 0 90 3 hupA DNA-binding protein HU-alpha Vibrio proteolyticus
Q87N46 9.05e-16 69 36 1 90 3 ihfB Integration host factor subunit beta Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q482G2 9.22e-16 69 36 1 94 3 ihfB Integration host factor subunit beta Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A7MUP0 9.29e-16 69 36 1 90 3 ihfB Integration host factor subunit beta Vibrio campbellii (strain ATCC BAA-1116)
Q7MLX5 9.99e-16 69 36 1 91 3 ihfB Integration host factor subunit beta Vibrio vulnificus (strain YJ016)
Q8D8J3 1.21e-15 68 36 1 90 3 ihfB Integration host factor subunit beta Vibrio vulnificus (strain CMCP6)
B7VH32 1.27e-15 68 36 1 90 3 ihfB Integration host factor subunit beta Vibrio atlanticus (strain LGP32)
B8F475 1.43e-15 68 38 1 91 3 ihfB Integration host factor subunit beta Glaesserella parasuis serovar 5 (strain SH0165)
P0ACF7 1.51e-15 68 36 0 86 3 hupB DNA-binding protein HU-beta Shigella flexneri
P0ACF4 1.51e-15 68 36 0 86 1 hupB DNA-binding protein HU-beta Escherichia coli (strain K12)
P0ACF5 1.51e-15 68 36 0 86 3 hupB DNA-binding protein HU-beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACF6 1.51e-15 68 36 0 86 3 hupB DNA-binding protein HU-beta Escherichia coli O157:H7
A1TZF1 1.68e-15 68 36 1 96 3 ihfB Integration host factor subunit beta Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A0KJ94 2.56e-15 68 32 1 90 3 ihfB Integration host factor subunit beta Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SLS6 2.61e-15 68 32 1 90 3 ihfB Integration host factor subunit beta Aeromonas salmonicida (strain A449)
A6W0A0 3.49e-15 68 37 1 90 3 ihfB Integration host factor subunit beta Marinomonas sp. (strain MWYL1)
Q9LA96 3.57e-15 67 37 0 90 3 hupA DNA-binding protein HU-alpha Aeromonas hydrophila
Q2SCF7 3.79e-15 67 36 1 93 3 ihfB Integration host factor subunit beta Hahella chejuensis (strain KCTC 2396)
Q9CK94 4.64e-15 67 36 0 90 3 hup DNA-binding protein HU Pasteurella multocida (strain Pm70)
P02344 5.23e-15 67 38 0 89 1 hupB DNA-binding protein HRm Rhizobium meliloti (strain 1021)
B5FG57 1.13e-14 66 36 1 93 3 ihfB Integration host factor subunit beta Aliivibrio fischeri (strain MJ11)
Q5E3Z3 1.13e-14 66 36 1 93 3 ihfB Integration host factor subunit beta Aliivibrio fischeri (strain ATCC 700601 / ES114)
C4LF00 1.18e-14 66 36 1 90 3 ihfB Integration host factor subunit beta Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A1S6D6 1.19e-14 66 35 1 91 3 ihfB Integration host factor subunit beta Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q82TD7 1.2e-14 66 35 2 97 3 ihfB Integration host factor subunit beta Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1QVK5 1.21e-14 66 34 1 93 3 ihfB Integration host factor subunit beta Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B0BP19 1.3e-14 66 40 1 91 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXH5 1.3e-14 66 40 1 91 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0A3 1.3e-14 66 40 1 91 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0BQI4 1.38e-14 66 34 1 96 3 ihfB Integration host factor subunit beta Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q0AIZ2 1.46e-14 66 34 1 93 3 ihfB Integration host factor subunit beta Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q15T07 1.52e-14 66 34 1 90 3 ihfB Integration host factor subunit beta Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q89WE8 1.57e-14 66 30 1 95 3 ihfB Integration host factor subunit beta Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9CI64 1.57e-14 66 40 0 84 1 hup DNA-binding protein HU Lactococcus lactis subsp. lactis (strain IL1403)
P02348 1.7e-14 65 37 0 89 1 None DNA-binding protein HRL53 Rhizobium leguminosarum
Q0AA51 1.71e-14 66 34 1 90 3 ihfB Integration host factor subunit beta Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
P43722 1.73e-14 65 36 0 86 3 hup DNA-binding protein HU Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A1KUD0 1.99e-14 66 34 1 96 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0U2 1.99e-14 66 34 1 96 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0U1 1.99e-14 66 34 1 96 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A0U3 1.99e-14 66 34 1 96 3 ihfB Integration host factor subunit beta Neisseria gonorrhoeae
Q89B22 2.05e-14 65 33 0 90 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P52680 2.42e-14 65 36 0 90 3 hupA DNA-binding protein HU-alpha Serratia marcescens
Q07UH4 2.52e-14 65 31 1 92 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisA53)
B6JCN9 2.52e-14 65 31 1 92 3 ihfB Integration host factor subunit beta Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A9H0B5 2.8e-14 65 34 1 97 3 ihfB Integration host factor subunit beta Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
P64389 2.85e-14 65 37 0 86 3 hupB DNA-binding protein HU-beta Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64388 2.85e-14 65 37 0 86 3 hupB DNA-binding protein HU-beta Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q081U7 2.87e-14 65 32 1 95 3 ihfB Integration host factor subunit beta Shewanella frigidimarina (strain NCIMB 400)
B6EIY1 3.11e-14 65 36 1 90 3 ihfB Integration host factor subunit beta Aliivibrio salmonicida (strain LFI1238)
P0ACF3 3.18e-14 65 36 0 90 3 hupA DNA-binding protein HU-alpha Shigella flexneri
E0J6W8 3.18e-14 65 36 0 90 1 hupA DNA-binding protein HU-alpha Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)
P0ACF0 3.18e-14 65 36 0 90 1 hupA DNA-binding protein HU-alpha Escherichia coli (strain K12)
P0ACF1 3.18e-14 65 36 0 90 3 hupA DNA-binding protein HU-alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACF2 3.18e-14 65 36 0 90 3 hupA DNA-binding protein HU-alpha Escherichia coli O157:H7
Q8P8P6 3.21e-14 65 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RSA5 3.21e-14 65 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain B100)
Q4UVD5 3.21e-14 65 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain 8004)
Q8PK78 3.21e-14 65 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas axonopodis pv. citri (strain 306)
B2SLH4 3.82e-14 65 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P3S1 3.82e-14 65 35 1 95 3 ihfB Integration host factor subunit beta Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A4YJI9 4.92e-14 65 29 1 96 3 ihfB Integration host factor subunit beta Bradyrhizobium sp. (strain ORS 278)
A9IL25 5.52e-14 64 31 1 92 3 ihfB Integration host factor subunit beta Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6LPE4 5.53e-14 64 34 1 90 3 ihfB Integration host factor subunit beta Photobacterium profundum (strain SS9)
C5BBR9 5.74e-14 64 36 1 87 3 ihfB Integration host factor subunit beta Edwardsiella ictaluri (strain 93-146)
A5E8A7 6.22e-14 64 29 1 95 3 ihfB Integration host factor subunit beta Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A1RJG1 6.28e-14 64 32 1 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain W3-18-1)
A4Y729 6.28e-14 64 32 1 91 3 ihfB Integration host factor subunit beta Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q3IL99 6.42e-14 64 33 1 93 3 ihfB Integration host factor subunit beta Pseudoalteromonas translucida (strain TAC 125)
A8LSF5 6.56e-14 64 37 0 78 3 ihfB Integration host factor subunit beta Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q0HV14 8.06e-14 64 32 1 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain MR-7)
Q0HIW8 8.06e-14 64 32 1 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain MR-4)
A0KWP0 8.06e-14 64 32 1 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain ANA-3)
Q8EEI1 8.06e-14 64 32 1 91 3 ihfB Integration host factor subunit beta Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q3SWL5 8.11e-14 64 30 1 92 3 ihfB Integration host factor subunit beta Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q1QS30 8.11e-14 64 30 1 92 3 ihfB Integration host factor subunit beta Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
P95519 8.19e-14 64 37 1 91 3 ihfB Integration host factor subunit beta Mannheimia haemolytica
Q87BJ8 8.54e-14 64 35 1 95 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6X0 8.54e-14 64 35 1 95 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain M23)
A3QEC3 1.01e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8GX11 1.03e-13 63 37 0 88 3 hup DNA-binding protein HU Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAV2 1.03e-13 63 37 0 88 3 hup DNA-binding protein HU Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A9L2X4 1.05e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS195)
A6WNM7 1.05e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS185)
A3D4A9 1.05e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EA98 1.05e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS223)
Q21CB6 1.15e-13 64 29 1 94 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisB18)
Q9PAQ8 1.18e-13 64 35 1 95 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain 9a5c)
P0A1R6 1.19e-13 63 35 0 90 3 hupA DNA-binding protein HU-alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R7 1.19e-13 63 35 0 90 3 hupA DNA-binding protein HU-alpha Salmonella typhi
Q9CML8 1.2e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Pasteurella multocida (strain Pm70)
Q12ND8 1.23e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B2FNP6 1.24e-13 63 36 1 95 3 ihfB Integration host factor subunit beta Stenotrophomonas maltophilia (strain K279a)
B4SSV3 1.24e-13 63 36 1 95 3 ihfB Integration host factor subunit beta Stenotrophomonas maltophilia (strain R551-3)
B1KF50 1.24e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Shewanella woodyi (strain ATCC 51908 / MS32)
Q65SH8 1.3e-13 63 34 1 91 3 ihfB Integration host factor subunit beta Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P05384 1.49e-13 63 33 0 86 1 hupB DNA-binding protein HU-beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A7IHH0 1.51e-13 63 31 1 90 3 ihfB Integration host factor subunit beta Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B8GRS4 1.75e-13 63 34 1 90 3 ihfB Integration host factor subunit beta Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q0ATJ4 1.87e-13 63 34 1 93 3 ihfB Integration host factor subunit beta Maricaulis maris (strain MCS10)
Q2J2G1 2e-13 63 29 1 94 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain HaA2)
A4VMF7 2.02e-13 63 33 1 90 3 ihfB Integration host factor subunit beta Stutzerimonas stutzeri (strain A1501)
Q28LB0 2.17e-13 63 35 1 90 3 ihfB Integration host factor subunit beta Jannaschia sp. (strain CCS1)
Q9ZDZ2 2.17e-13 63 42 0 71 3 hup DNA-binding protein HU Rickettsia prowazekii (strain Madrid E)
Q51473 2.21e-13 63 33 1 90 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PW7 2.21e-13 63 33 1 90 1 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VAL8 2.21e-13 63 33 1 90 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain LESB58)
A6V2R4 2.21e-13 63 33 1 90 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain PA7)
A8FVN3 2.21e-13 63 31 1 91 3 ihfB Integration host factor subunit beta Shewanella sediminis (strain HAW-EB3)
O83278 2.3e-13 63 37 0 88 3 hup DNA-binding protein HU Treponema pallidum (strain Nichols)
Q9HTL0 2.57e-13 62 33 0 89 3 hupA DNA-binding protein HU-alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A8H4A7 2.58e-13 63 32 1 91 3 ihfB Integration host factor subunit beta Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
P29214 3.02e-13 62 32 0 92 3 hup DNA-binding protein HU homolog Guillardia theta
Q8KA69 3.06e-13 62 34 0 90 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A6VPK8 3.3e-13 62 36 1 91 3 ihfB Integration host factor subunit beta Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A6T704 3.61e-13 62 34 1 87 3 ihfB Integration host factor subunit beta Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XY84 3.69e-13 62 34 1 87 3 ihfB Integration host factor subunit beta Klebsiella pneumoniae (strain 342)
A9MHX0 3.72e-13 62 34 1 87 3 ihfB Integration host factor subunit beta Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B0TT46 3.85e-13 62 32 1 91 3 ihfB Integration host factor subunit beta Shewanella halifaxensis (strain HAW-EB4)
P57144 3.9e-13 62 35 0 91 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q7N6D2 4.06e-13 62 33 1 90 3 ihfB Integration host factor subunit beta Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2RXP8 4.45e-13 62 34 1 87 3 ihfB Integration host factor subunit beta Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A4W8T1 5.05e-13 62 34 1 87 3 ihfB Integration host factor subunit beta Enterobacter sp. (strain 638)
C1DRR5 5.41e-13 62 32 1 90 3 ihfB Integration host factor subunit beta Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
P36206 5.74e-13 62 35 0 90 1 hup DNA-binding protein HU Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q44654 6.05e-13 62 34 1 87 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A4XTF3 6.15e-13 62 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas mendocina (strain ymp)
A6T1G0 6.73e-13 62 32 1 91 3 ihfB Integration host factor subunit beta Janthinobacterium sp. (strain Marseille)
A4G858 6.73e-13 62 32 1 91 3 ihfB Integration host factor subunit beta Herminiimonas arsenicoxydans
B3Q602 7e-13 62 28 1 94 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain TIE-1)
Q6NDN9 7e-13 62 28 1 94 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B6IUP4 7.19e-13 62 33 1 90 3 ihfB Integration host factor subunit beta Rhodospirillum centenum (strain ATCC 51521 / SW)
B8D7K1 7.37e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57394 7.37e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D999 7.37e-13 62 33 1 87 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q68XJ6 7.55e-13 62 40 0 71 3 hup DNA-binding protein HU Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q47GJ8 8.04e-13 61 31 1 94 3 ihfB Integration host factor subunit beta Dechloromonas aromatica (strain RCB)
P05514 8.49e-13 61 33 0 89 1 hup DNA-binding protein HU Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q13EQ5 8.54e-13 62 29 1 92 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisB5)
P0A129 8.62e-13 62 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida
P0A128 8.62e-13 62 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3Z3K9 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Shigella sonnei (strain Ss046)
P0A6Y4 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Shigella flexneri
Q0SX03 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Shigella flexneri serotype 5b (strain 8401)
Q32E32 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Shigella dysenteriae serotype 1 (strain Sd197)
Q31YT8 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Shigella boydii serotype 4 (strain Sb227)
B2TUG9 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RDU6 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain UTI89 / UPEC)
B1LJV1 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain SMS-3-5 / SECEC)
B6I8Y4 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain SE11)
B7NAR1 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6Y1 8.77e-13 61 33 1 87 1 ihfB Integration host factor subunit beta Escherichia coli (strain K12)
B1IW19 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6Y2 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJE1 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZYL5 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O9:H4 (strain HS)
B1X852 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain K12 / DH10B)
C4ZQ38 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain K12 / MC4100 / BW2952)
B7M841 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O8 (strain IAI1)
B7MS27 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O81 (strain ED1a)
B7NM62 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT46 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6Y3 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O157:H7
B7LDA4 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli (strain 55989 / EAEC)
B7MHM1 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZK01 8.77e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Escherichia coli O139:H28 (strain E24377A / ETEC)
B0KTY3 9.25e-13 61 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain GB-1)
A5W7F5 9.25e-13 61 32 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P64394 9.36e-13 61 33 1 87 3 ihfB Integration host factor subunit beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03365
Feature type CDS
Gene ihfA
Product integration host factor subunit alpha
Location 718319 - 718615 (strand: 1)
Length 297 (nucleotides) / 98 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1805
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00216 Bacterial DNA-binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0776 Replication, recombination and repair (L) L Bacterial nucleoid DNA-binding protein IHF-alpha

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04764 integration host factor subunit alpha - -

Protein Sequence

MALTKAEMSENLSETLDLSKRDAKDLVELFFEEVRRSLENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKAKVEKSTPKE

Flanking regions ( +/- flanking 50bp)

TGTTGCCGCGTTGCAACAGCGATTTAAAGCATCCTTGAGGGACTAAACCTATGGCGCTTACTAAAGCTGAAATGTCAGAAAATTTGTCGGAAACGCTGGATCTCAGCAAACGCGATGCGAAGGATCTGGTAGAACTGTTTTTTGAAGAAGTACGTCGTTCTCTTGAGAATGGCGAGCAGGTAAAATTATCCGGTTTCGGAAACTTTGATCTGCGGGACAAAAATCAGCGTCCGGGCCGCAACCCTAAGACGGGTGAAGATATTCCTATCACGGCACGCAGAGTTGTCACTTTCCGTCCGGGGCAGAAATTGAAGGCCAAGGTCGAGAAATCGACACCGAAAGAGTAAGACCTGAAACGACCTCTTATGAGGTCGTTTTCTTTTCTGTGGTTTGTCAG