Homologs in group_2180

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16415 FBDBKF_16415 100.0 Morganella morganii S1 mgrB PhoP regulon feedback inhibition membrane protein MgrB
EHELCC_08280 EHELCC_08280 100.0 Morganella morganii S2 mgrB PhoP regulon feedback inhibition membrane protein MgrB
LHKJJB_05660 LHKJJB_05660 100.0 Morganella morganii S3 mgrB PhoP regulon feedback inhibition membrane protein MgrB
HKOGLL_05255 HKOGLL_05255 100.0 Morganella morganii S5 mgrB PhoP regulon feedback inhibition membrane protein MgrB
F4V73_RS02935 F4V73_RS02935 86.4 Morganella psychrotolerans mgrB PhoP/PhoQ regulator MgrB
PMI_RS19640 PMI_RS19640 54.5 Proteus mirabilis HI4320 mgrB PhoP/PhoQ regulator MgrB

Distribution of the homologs in the orthogroup group_2180

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2180

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0DM79 2.41e-07 44 43 0 44 3 mgrB PhoP/PhoQ regulator MgrB Yersinia pestis
A4WBI4 0.000361 36 36 1 46 3 mgrB PhoP/PhoQ regulator MgrB Enterobacter sp. (strain 638)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_08605
Feature type CDS
Gene mgrB
Product PhoP regulon feedback inhibition membrane protein MgrB
Location 124537 - 124671 (strand: 1)
Length 135 (nucleotides) / 44 (amino acids)

Contig

Accession ZDB_523
Length 257158 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2180
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13998 MgrB protein

Protein Sequence

MKKIIIILLLIVAGVFFYIAALDKYCDQREDFMLGICEITKFFP

Flanking regions ( +/- flanking 50bp)

TGTAACGAAATCTTTTAAACGGGTATAATTCAGATGAAAATAGGCGAAACATGAAAAAAATCATAATTATCCTGCTGCTGATTGTTGCCGGTGTATTTTTTTATATTGCGGCGCTCGATAAGTACTGTGATCAGCGTGAGGATTTTATGCTGGGAATCTGTGAAATTACGAAATTTTTTCCGTAAGATAAGGGCTGAGTTTTGCCTTTTCCCTCTGATTATCTTGTTGCTAACGG