Homologs in group_2216

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16415 FBDBKF_16415 100.0 Morganella morganii S1 mgrB PhoP regulon feedback inhibition membrane protein MgrB
NLDBIP_08605 NLDBIP_08605 100.0 Morganella morganii S4 mgrB PhoP regulon feedback inhibition membrane protein MgrB
LHKJJB_05660 LHKJJB_05660 100.0 Morganella morganii S3 mgrB PhoP regulon feedback inhibition membrane protein MgrB
HKOGLL_05255 HKOGLL_05255 100.0 Morganella morganii S5 mgrB PhoP regulon feedback inhibition membrane protein MgrB
F4V73_RS02935 F4V73_RS02935 86.4 Morganella psychrotolerans mgrB PhoP/PhoQ regulator MgrB
PMI_RS19640 PMI_RS19640 54.5 Proteus mirabilis HI4320 mgrB PhoP/PhoQ regulator MgrB

Distribution of the homologs in the orthogroup group_2216

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2216

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0DM79 2.41e-07 44 43 0 44 3 mgrB PhoP/PhoQ regulator MgrB Yersinia pestis
A4WBI4 0.000361 36 36 1 46 3 mgrB PhoP/PhoQ regulator MgrB Enterobacter sp. (strain 638)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_08280
Feature type CDS
Gene mgrB
Product PhoP regulon feedback inhibition membrane protein MgrB
Location 124537 - 124671 (strand: 1)
Length 135 (nucleotides) / 44 (amino acids)
In genomic island -

Contig

Accession ZDB_217
Length 250991 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2216
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13998 MgrB protein

Protein Sequence

MKKIIIILLLIVAGVFFYIAALDKYCDQREDFMLGICEITKFFP

Flanking regions ( +/- flanking 50bp)

TGTAACGAAATCTTTTAAACGGGTATAATTCAGATGAAAATAGGCGAAACATGAAAAAAATCATAATTATCCTGCTGCTGATTGTTGCCGGTGTATTTTTTTATATTGCGGCGCTCGATAAGTACTGTGATCAGCGTGAGGATTTTATGCTGGGAATCTGTGAAATTACGAAATTTTTTCCGTAAGATAAGGGCTGAGTTTTGCCTTTTCCCTCTGATTATCTTGTTGCTAACGG