Homologs in group_2216

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16415 FBDBKF_16415 86.4 Morganella morganii S1 mgrB PhoP regulon feedback inhibition membrane protein MgrB
EHELCC_08280 EHELCC_08280 86.4 Morganella morganii S2 mgrB PhoP regulon feedback inhibition membrane protein MgrB
NLDBIP_08605 NLDBIP_08605 86.4 Morganella morganii S4 mgrB PhoP regulon feedback inhibition membrane protein MgrB
LHKJJB_05660 LHKJJB_05660 86.4 Morganella morganii S3 mgrB PhoP regulon feedback inhibition membrane protein MgrB
HKOGLL_05255 HKOGLL_05255 86.4 Morganella morganii S5 mgrB PhoP regulon feedback inhibition membrane protein MgrB
PMI_RS19640 PMI_RS19640 43.8 Proteus mirabilis HI4320 mgrB PhoP/PhoQ regulator MgrB

Distribution of the homologs in the orthogroup group_2216

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2216

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0DM79 4.57e-07 43 45 0 44 3 mgrB PhoP/PhoQ regulator MgrB Yersinia pestis
B5XQ45 7.21e-05 38 43 1 46 3 mgrB PhoP/PhoQ regulator MgrB Klebsiella pneumoniae (strain 342)
A4WBI4 0.000357 36 35 0 42 3 mgrB PhoP/PhoQ regulator MgrB Enterobacter sp. (strain 638)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS02935
Feature type CDS
Gene mgrB
Product PhoP/PhoQ regulator MgrB
Location 622797 - 622943 (strand: 1)
Length 147 (nucleotides) / 48 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2216
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13998 MgrB protein

Protein Sequence

MKKAVIILLLIIVGVLFYIAALDKYCDQREDFMLGICEITKFIPSEKG

Flanking regions ( +/- flanking 50bp)

CATAACTAAATCTTTTTAACGGGTATAATTCAGATGAAAATAGGTGAAAAATGAAGAAAGCCGTGATTATCTTGCTGCTTATTATTGTCGGTGTGCTTTTTTATATCGCAGCGCTGGACAAGTACTGTGACCAGCGTGAGGATTTTATGTTGGGGATCTGCGAAATTACAAAATTTATTCCGTCTGAGAAGGGGTGATGTCGGTCTTTTCCCTCTGATTATCTTGTTGTTAACGGTATTCAAGTCAG