Homologs in group_3024

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17975 FBDBKF_17975 100.0 Morganella morganii S1 fimD Outer membrane usher protein FimD/PapC
EHELCC_06360 EHELCC_06360 100.0 Morganella morganii S2 fimD Outer membrane usher protein FimD/PapC
LHKJJB_19280 LHKJJB_19280 100.0 Morganella morganii S3 fimD Outer membrane usher protein FimD/PapC
HKOGLL_04710 HKOGLL_04710 100.0 Morganella morganii S5 fimD Outer membrane usher protein FimD/PapC
PMI_RS19090 PMI_RS19090 100.0 Proteus mirabilis HI4320 - FimD/PapC N-terminal domain-containing protein

Distribution of the homologs in the orthogroup group_3024

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3024

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77468 0.000675 39 40 2 50 2 sfmD Outer membrane usher protein SfmD Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_06680
Feature type CDS
Gene fimD
Product Outer membrane usher protein FimD/PapC
Location 1439 - 1657 (strand: 1)
Length 219 (nucleotides) / 72 (amino acids)

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3024
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF13954 PapC N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3188 Cell motility (N)
Extracellular structures (W)		 NW Outer membrane usher protein FimD/PapC

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042617 fimbrial biogenesis outer membrane usher protein VF1235 Adherence

Protein Sequence

MDTVAMEYAEFDPSFLQHTQGKTTLDIHRFNQGNPTPAGKYYADVYLNNKWKGLCLSVSYAICHINIFGVYT

Flanking regions ( +/- flanking 50bp)

AACATCATTCATTCCTGCCTGCCATATTTATTTCACTGGGAGTTTTTTCCATGGACACAGTGGCTATGGAATATGCTGAATTTGATCCCAGTTTTTTACAGCATACTCAAGGGAAGACGACGTTAGATATTCATCGTTTCAATCAAGGAAATCCAACTCCAGCAGGAAAGTACTATGCTGATGTTTATCTTAATAATAAATGGAAAGGGCTCTGCCTTAGTGTTTCTTACGCCATTTGTCACATTAACATTTTTGGTGTTTACACCTGAAACCTGGGTACATGGAGCAGATGCTCATACTGAGTTTCCTTATCTTTCCG