Homologs in group_1230

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07165 FBDBKF_07165 100.0 Morganella morganii S1 ihfB integration host factor subunit beta
EHELCC_03805 EHELCC_03805 100.0 Morganella morganii S2 ihfB integration host factor subunit beta
LHKJJB_09635 LHKJJB_09635 100.0 Morganella morganii S3 ihfB integration host factor subunit beta
HKOGLL_09340 HKOGLL_09340 100.0 Morganella morganii S5 ihfB integration host factor subunit beta
F4V73_RS01350 F4V73_RS01350 98.9 Morganella psychrotolerans ihfB integration host factor subunit beta
PMI_RS03520 PMI_RS03520 85.1 Proteus mirabilis HI4320 ihfB integration host factor subunit beta

Distribution of the homologs in the orthogroup group_1230

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1230

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JRD6 1.75e-58 177 89 0 94 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CI5 1.75e-58 177 89 0 94 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TN15 1.75e-58 177 89 0 94 3 ihfB Integration host factor subunit beta Yersinia pestis (strain Pestoides F)
Q1CGG8 1.75e-58 177 89 0 94 3 ihfB Integration host factor subunit beta Yersinia pestis bv. Antiqua (strain Nepal516)
A9R7I5 1.75e-58 177 89 0 94 3 ihfB Integration host factor subunit beta Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGB1 1.75e-58 177 89 0 94 3 ihfB Integration host factor subunit beta Yersinia pestis
B2KA26 1.75e-58 177 89 0 94 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CA70 1.75e-58 177 89 0 94 3 ihfB Integration host factor subunit beta Yersinia pestis bv. Antiqua (strain Antiqua)
A7FJW6 1.75e-58 177 89 0 94 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GCH4 2.84e-58 176 88 0 94 3 ihfB Integration host factor subunit beta Serratia proteamaculans (strain 568)
C5BBR9 3e-58 176 89 0 94 3 ihfB Integration host factor subunit beta Edwardsiella ictaluri (strain 93-146)
P37983 7.53e-58 175 88 0 94 3 ihfB Integration host factor subunit beta Dickeya dadantii (strain 3937)
B2VC76 8.67e-58 175 87 0 94 3 ihfB Integration host factor subunit beta Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DF68 1.06e-57 175 87 0 94 3 ihfB Integration host factor subunit beta Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D404 1.06e-57 175 87 0 94 3 ihfB Integration host factor subunit beta Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P23303 1.57e-57 174 87 0 94 3 ihfB Integration host factor subunit beta Serratia marcescens
A1JMJ0 1.62e-57 174 88 0 94 3 ihfB Integration host factor subunit beta Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B7LN74 3.54e-57 173 87 0 94 3 ihfB Integration host factor subunit beta Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q7N6D2 6.7e-57 173 87 0 93 3 ihfB Integration host factor subunit beta Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B5XY84 8.6e-57 172 87 0 93 3 ihfB Integration host factor subunit beta Klebsiella pneumoniae (strain 342)
A6T704 9.81e-57 172 87 0 93 3 ihfB Integration host factor subunit beta Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9MHX0 9.94e-57 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3Z3K9 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Shigella sonnei (strain Ss046)
P0A6Y4 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Shigella flexneri
Q0SX03 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Shigella flexneri serotype 5b (strain 8401)
Q32E32 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Shigella dysenteriae serotype 1 (strain Sd197)
Q31YT8 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Shigella boydii serotype 4 (strain Sb227)
B2TUG9 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RDU6 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli (strain UTI89 / UPEC)
B1LJV1 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli (strain SMS-3-5 / SECEC)
B6I8Y4 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli (strain SE11)
B7NAR1 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6Y1 1.13e-56 172 86 0 94 1 ihfB Integration host factor subunit beta Escherichia coli (strain K12)
B1IW19 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6Y2 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJE1 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZYL5 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O9:H4 (strain HS)
B1X852 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli (strain K12 / DH10B)
C4ZQ38 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli (strain K12 / MC4100 / BW2952)
B7M841 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O8 (strain IAI1)
B7MS27 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O81 (strain ED1a)
B7NM62 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT46 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6Y3 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O157:H7
B7LDA4 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli (strain 55989 / EAEC)
B7MHM1 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZK01 1.13e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O139:H28 (strain E24377A / ETEC)
P64394 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64395 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella typhi
B4TRU3 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella schwarzengrund (strain CVM19633)
B5BBP5 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella paratyphi A (strain AKU_12601)
C0PXU8 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella paratyphi C (strain RKS4594)
A9N7V2 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGG9 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T146 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella newport (strain SL254)
B4TD42 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella heidelberg (strain SL476)
B5R8J9 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZB6 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella enteritidis PT4 (strain P125109)
B5FQ55 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella dublin (strain CT_02021853)
Q57R19 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella choleraesuis (strain SC-B67)
B5F165 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Salmonella agona (strain SL483)
A8AIH1 1.49e-56 172 86 0 94 3 ihfB Integration host factor subunit beta Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4W8T1 2.03e-56 172 85 0 94 3 ihfB Integration host factor subunit beta Enterobacter sp. (strain 638)
B7UMZ8 2.32e-56 171 85 0 94 3 ihfB Integration host factor subunit beta Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B4ET28 2.97e-56 171 85 0 94 3 ihfB Integration host factor subunit beta Proteus mirabilis (strain HI4320)
Q2NUA6 7.92e-56 170 85 0 94 3 ihfB Integration host factor subunit beta Sodalis glossinidius (strain morsitans)
Q6LPE4 1.59e-52 162 82 0 91 3 ihfB Integration host factor subunit beta Photobacterium profundum (strain SS9)
Q8D8J3 1.18e-49 154 78 0 92 3 ihfB Integration host factor subunit beta Vibrio vulnificus (strain CMCP6)
A7MUP0 1.5e-49 154 78 0 92 3 ihfB Integration host factor subunit beta Vibrio campbellii (strain ATCC BAA-1116)
Q87N46 1.78e-49 154 78 0 92 3 ihfB Integration host factor subunit beta Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LNL8 4.1e-49 153 78 0 92 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain M66-2)
Q9KQT4 4.1e-49 153 78 0 92 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6Y4 4.1e-49 153 78 0 92 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B7VH32 5.36e-49 153 78 0 91 3 ihfB Integration host factor subunit beta Vibrio atlanticus (strain LGP32)
A0KJ94 7.88e-49 152 77 0 92 3 ihfB Integration host factor subunit beta Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SLS6 9.09e-49 152 77 0 92 3 ihfB Integration host factor subunit beta Aeromonas salmonicida (strain A449)
Q7MLX5 1.19e-48 152 77 0 92 3 ihfB Integration host factor subunit beta Vibrio vulnificus (strain YJ016)
Q482G2 1.79e-48 152 79 0 92 3 ihfB Integration host factor subunit beta Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3IL99 2.09e-48 151 79 0 91 3 ihfB Integration host factor subunit beta Pseudoalteromonas translucida (strain TAC 125)
A6W0A0 6.08e-48 150 76 0 92 3 ihfB Integration host factor subunit beta Marinomonas sp. (strain MWYL1)
A1S6D6 6.9e-48 150 80 0 91 3 ihfB Integration host factor subunit beta Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q15T07 1.81e-47 149 78 0 91 3 ihfB Integration host factor subunit beta Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1RJG1 2.49e-47 149 78 0 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain W3-18-1)
A4Y729 2.49e-47 149 78 0 91 3 ihfB Integration host factor subunit beta Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8H4A7 3.21e-47 148 78 0 91 3 ihfB Integration host factor subunit beta Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TT46 5.14e-47 148 78 0 91 3 ihfB Integration host factor subunit beta Shewanella halifaxensis (strain HAW-EB4)
A3QEC3 6.69e-47 147 78 0 91 3 ihfB Integration host factor subunit beta Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0HV14 7.71e-47 147 78 0 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain MR-7)
Q0HIW8 7.71e-47 147 78 0 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain MR-4)
A0KWP0 7.71e-47 147 78 0 91 3 ihfB Integration host factor subunit beta Shewanella sp. (strain ANA-3)
Q8EEI1 7.71e-47 147 78 0 91 3 ihfB Integration host factor subunit beta Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q081U7 1.38e-46 147 76 0 91 3 ihfB Integration host factor subunit beta Shewanella frigidimarina (strain NCIMB 400)
Q12ND8 1.78e-46 146 76 0 91 3 ihfB Integration host factor subunit beta Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9L2X4 1.96e-46 146 76 0 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS195)
A6WNM7 1.96e-46 146 76 0 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS185)
A3D4A9 1.96e-46 146 76 0 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EA98 1.96e-46 146 76 0 91 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS223)
C5BSK5 1.04e-45 145 75 0 91 3 ihfB Integration host factor subunit beta Teredinibacter turnerae (strain ATCC 39867 / T7901)
B1KF50 1.72e-45 144 75 0 91 3 ihfB Integration host factor subunit beta Shewanella woodyi (strain ATCC 51908 / MS32)
C4LF00 2.54e-45 144 76 0 91 3 ihfB Integration host factor subunit beta Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A8FVN3 4.14e-45 143 73 0 91 3 ihfB Integration host factor subunit beta Shewanella sediminis (strain HAW-EB3)
A4VMF7 6.6e-45 142 74 0 91 3 ihfB Integration host factor subunit beta Stutzerimonas stutzeri (strain A1501)
C1DRR5 8.9e-45 142 73 0 91 3 ihfB Integration host factor subunit beta Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B5FG57 2.41e-44 141 73 0 91 3 ihfB Integration host factor subunit beta Aliivibrio fischeri (strain MJ11)
Q5E3Z3 2.41e-44 141 73 0 91 3 ihfB Integration host factor subunit beta Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EIY1 3.74e-44 140 71 0 92 3 ihfB Integration host factor subunit beta Aliivibrio salmonicida (strain LFI1238)
Q51473 8.3e-44 140 73 0 91 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PW7 8.3e-44 140 73 0 91 1 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VAL8 8.3e-44 140 73 0 91 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain LESB58)
A6V2R4 8.3e-44 140 73 0 91 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain PA7)
Q0AA51 1.01e-43 140 75 0 91 3 ihfB Integration host factor subunit beta Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1SYZ9 1.19e-43 139 71 0 91 3 ihfB Integration host factor subunit beta Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B1J5H2 2.15e-43 139 73 0 91 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain W619)
B0KTY3 2.62e-43 139 72 0 91 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain GB-1)
A5W7F5 2.62e-43 139 72 0 91 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q21IT4 2.87e-43 139 71 0 91 3 ihfB Integration host factor subunit beta Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A4XTF3 3.19e-43 138 71 0 91 3 ihfB Integration host factor subunit beta Pseudomonas mendocina (strain ymp)
P0A129 5.38e-43 138 72 0 91 3 ihfB Integration host factor subunit beta Pseudomonas putida
P0A128 5.38e-43 138 72 0 91 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1ID97 5.53e-43 138 71 0 91 3 ihfB Integration host factor subunit beta Pseudomonas entomophila (strain L48)
C3K6K2 8.49e-43 137 71 0 91 3 ihfB Integration host factor subunit beta Pseudomonas fluorescens (strain SBW25)
B8GRS4 8.63e-43 137 73 0 91 3 ihfB Integration host factor subunit beta Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q4ZQ99 8.87e-43 137 71 0 91 3 ihfB Integration host factor subunit beta Pseudomonas syringae pv. syringae (strain B728a)
Q885T0 8.87e-43 137 71 0 91 3 ihfB Integration host factor subunit beta Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3K8V7 9.9e-43 137 71 0 91 3 ihfB Integration host factor subunit beta Pseudomonas fluorescens (strain Pf0-1)
Q48FN3 2.09e-42 136 71 0 91 3 ihfB Integration host factor subunit beta Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B2SLH4 4.84e-42 135 71 0 91 3 ihfB Integration host factor subunit beta Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P3S1 4.84e-42 135 71 0 91 3 ihfB Integration host factor subunit beta Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8P8P6 5.06e-42 135 71 0 91 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RSA5 5.06e-42 135 71 0 91 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain B100)
Q4UVD5 5.06e-42 135 71 0 91 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain 8004)
Q8PK78 5.11e-42 135 71 0 91 3 ihfB Integration host factor subunit beta Xanthomonas axonopodis pv. citri (strain 306)
A1WUI6 1.5e-41 134 71 0 91 3 ihfB Integration host factor subunit beta Halorhodospira halophila (strain DSM 244 / SL1)
Q2SCF7 1.79e-41 134 70 0 91 3 ihfB Integration host factor subunit beta Hahella chejuensis (strain KCTC 2396)
B0UUH4 2.36e-41 134 64 0 94 3 ihfB Integration host factor subunit beta Histophilus somni (strain 2336)
Q0I390 2.36e-41 134 64 0 94 3 ihfB Integration host factor subunit beta Histophilus somni (strain 129Pt)
B2FNP6 2.91e-41 134 71 0 91 3 ihfB Integration host factor subunit beta Stenotrophomonas maltophilia (strain K279a)
B4SSV3 2.91e-41 134 71 0 91 3 ihfB Integration host factor subunit beta Stenotrophomonas maltophilia (strain R551-3)
Q9CML8 3.62e-41 133 68 0 94 3 ihfB Integration host factor subunit beta Pasteurella multocida (strain Pm70)
A1TZF1 6.82e-41 132 68 0 91 3 ihfB Integration host factor subunit beta Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
B8D7K1 1.56e-40 131 64 0 93 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57394 1.56e-40 131 64 0 93 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D999 1.56e-40 131 64 0 93 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q5QZ46 3.18e-40 130 68 1 94 3 ihfB Integration host factor subunit beta Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q057N8 4.87e-40 130 63 0 91 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q65SH8 5.08e-40 130 67 0 94 3 ihfB Integration host factor subunit beta Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q608S8 6.38e-40 130 69 0 91 3 ihfB Integration host factor subunit beta Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q44654 1.15e-39 129 59 0 91 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9PAQ8 1.49e-39 129 68 0 90 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain 9a5c)
P95519 3.01e-39 128 65 0 92 3 ihfB Integration host factor subunit beta Mannheimia haemolytica
B8F475 4.05e-39 128 65 0 92 3 ihfB Integration host factor subunit beta Glaesserella parasuis serovar 5 (strain SH0165)
Q87BJ8 4.37e-39 128 68 0 90 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6X0 4.37e-39 128 68 0 90 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain M23)
A6VPK8 5.14e-39 127 63 0 94 3 ihfB Integration host factor subunit beta Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q1QVK5 5.66e-39 127 67 0 91 3 ihfB Integration host factor subunit beta Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A5UF83 1.29e-37 124 59 0 94 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain PittGG)
Q7VLR8 2.15e-37 124 61 0 92 3 ihfB Integration host factor subunit beta Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P43724 8.15e-37 122 59 0 94 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B0BP19 1.28e-36 122 63 0 92 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXH5 1.28e-36 122 63 0 92 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0A3 1.28e-36 122 63 0 92 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A5UBN4 1.47e-36 121 58 0 94 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain PittEE)
Q4QJU8 1.47e-36 121 58 0 94 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain 86-028NP)
A1K4D5 2.91e-35 118 63 0 92 3 ihfB Integration host factor subunit beta Azoarcus sp. (strain BH72)
A9IJJ1 6.77e-35 118 61 0 92 3 ihfB Integration host factor subunit beta Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7W605 1.07e-34 117 60 0 92 3 ihfB Integration host factor subunit beta Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7NTK9 3.02e-34 116 62 1 96 3 ihfB Integration host factor subunit beta Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
C1D546 4.14e-34 115 63 0 91 3 ihfB Integration host factor subunit beta Laribacter hongkongensis (strain HLHK9)
Q2Y7A9 4.55e-34 115 61 0 91 3 ihfB Integration host factor subunit beta Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q47GJ8 2.63e-33 113 61 0 91 3 ihfB Integration host factor subunit beta Dechloromonas aromatica (strain RCB)
A6T1G0 2.73e-33 113 59 0 91 3 ihfB Integration host factor subunit beta Janthinobacterium sp. (strain Marseille)
A4G858 2.73e-33 113 59 0 91 3 ihfB Integration host factor subunit beta Herminiimonas arsenicoxydans
A1KUD0 1.19e-32 112 58 1 97 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0U2 1.19e-32 112 58 1 97 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0U1 1.19e-32 112 58 1 97 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A0U3 1.19e-32 112 58 1 97 3 ihfB Integration host factor subunit beta Neisseria gonorrhoeae
Q8Y0Y3 5.85e-32 111 61 0 91 3 ihfB Integration host factor subunit beta Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A5EWQ2 7.54e-32 110 57 0 91 3 ihfB Integration host factor subunit beta Dichelobacter nodosus (strain VCS1703A)
B2JF07 3.57e-31 108 59 0 91 3 ihfB Integration host factor subunit beta Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q46Y54 4.38e-31 109 60 0 91 3 ihfB Integration host factor subunit beta Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0AIZ2 5.7e-31 107 63 0 88 3 ihfB Integration host factor subunit beta Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q63S07 6.45e-31 107 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain K96243)
A3NC29 6.45e-31 107 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain 668)
Q3JPY2 6.45e-31 107 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain 1710b)
A3NXW8 6.45e-31 107 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain 1106a)
A1V6M0 6.45e-31 107 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain SAVP1)
Q62M28 6.45e-31 107 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain ATCC 23344)
A2S4R7 6.45e-31 107 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain NCTC 10229)
A3MHP1 6.45e-31 107 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain NCTC 10247)
Q2SY23 7.52e-31 107 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1LQG7 1.13e-30 108 60 0 91 3 ihfB Integration host factor subunit beta Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q82TD7 1.82e-30 106 62 0 88 3 ihfB Integration host factor subunit beta Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1BY25 1.97e-30 106 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia orbicola (strain AU 1054)
B1JXS2 1.97e-30 106 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia orbicola (strain MC0-3)
A0K5M4 1.97e-30 106 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia cenocepacia (strain HI2424)
Q39IF8 2.22e-30 106 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EB39 2.22e-30 106 58 0 91 3 ihfB Integration host factor subunit beta Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B2T634 4.1e-30 105 58 0 91 3 ihfB Integration host factor subunit beta Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q13VC5 6.78e-30 105 58 0 91 3 ihfB Integration host factor subunit beta Paraburkholderia xenovorans (strain LB400)
A9ADV3 7.57e-30 105 57 0 91 3 ihfB Integration host factor subunit beta Burkholderia multivorans (strain ATCC 17616 / 249)
A4JCH7 2.24e-29 103 57 0 91 3 ihfB Integration host factor subunit beta Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BH90 2.24e-29 103 57 0 91 3 ihfB Integration host factor subunit beta Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YV36 2.24e-29 103 57 0 91 3 ihfB Integration host factor subunit beta Burkholderia ambifaria (strain MC40-6)
Q28LB0 3.73e-29 103 53 0 91 3 ihfB Integration host factor subunit beta Jannaschia sp. (strain CCS1)
Q1GK81 5.9e-29 102 52 0 91 3 ihfB Integration host factor subunit beta Ruegeria sp. (strain TM1040)
B0T273 8.23e-29 102 56 0 91 3 ihfB Integration host factor subunit beta Caulobacter sp. (strain K31)
Q0ATJ4 9.51e-29 102 54 0 91 3 ihfB Integration host factor subunit beta Maricaulis maris (strain MCS10)
Q9X4E2 9.64e-29 102 53 0 91 3 ihfB Integration host factor subunit beta Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B9KU92 9.75e-29 102 53 0 91 3 ihfB Integration host factor subunit beta Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A3PPV4 9.75e-29 102 53 0 91 3 ihfB Integration host factor subunit beta Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B8H6A5 9.83e-29 102 56 0 91 3 ihfB Integration host factor subunit beta Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A2H5 9.83e-29 102 56 0 91 3 ihfB Integration host factor subunit beta Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A8IN83 1.19e-28 101 50 0 91 3 ihfB Integration host factor subunit beta Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A7IHH0 1.54e-28 101 52 0 91 3 ihfB Integration host factor subunit beta Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q161H6 2.3e-28 100 52 0 91 3 ihfB Integration host factor subunit beta Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5LV98 2.96e-28 100 50 0 91 3 ihfB Integration host factor subunit beta Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q8G304 4.4e-28 100 51 0 91 3 ihfB Integration host factor subunit beta Brucella suis biovar 1 (strain 1330)
B0CIR1 4.4e-28 100 51 0 91 3 ihfB Integration host factor subunit beta Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VN89 4.4e-28 100 51 0 91 3 ihfB Integration host factor subunit beta Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9M798 4.4e-28 100 51 0 91 3 ihfB Integration host factor subunit beta Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A6WV92 4.4e-28 100 51 0 91 3 ihfB Integration host factor subunit beta Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q0BQI4 5.34e-28 100 52 0 91 3 ihfB Integration host factor subunit beta Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B6IUP4 1.24e-27 99 50 0 91 3 ihfB Integration host factor subunit beta Rhodospirillum centenum (strain ATCC 51521 / SW)
Q57FM3 1.65e-27 99 50 0 91 3 ihfB Integration host factor subunit beta Brucella abortus biovar 1 (strain 9-941)
Q2YP18 1.65e-27 99 50 0 91 3 ihfB Integration host factor subunit beta Brucella abortus (strain 2308)
B2S8E6 1.65e-27 99 50 0 91 3 ihfB Integration host factor subunit beta Brucella abortus (strain S19)
B8EMZ0 1.79e-27 99 49 0 91 3 ihfB Integration host factor subunit beta Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A9IL25 3.67e-27 97 49 0 91 3 ihfB Integration host factor subunit beta Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q98GS0 4.01e-27 97 51 0 91 3 ihfB Integration host factor subunit beta Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2RXP8 6.39e-27 97 49 0 91 3 ihfB Integration host factor subunit beta Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B6JCN9 7.99e-27 97 51 0 91 3 ihfB Integration host factor subunit beta Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A9H0B5 9.05e-27 97 51 0 91 3 ihfB Integration host factor subunit beta Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q07UH4 1.04e-26 97 51 0 91 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisA53)
Q8YET3 1.61e-26 96 49 0 91 3 ihfB Integration host factor subunit beta Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RGK7 1.61e-26 96 49 0 91 3 ihfB Integration host factor subunit beta Brucella melitensis biotype 2 (strain ATCC 23457)
Q11C35 1.88e-26 96 50 0 91 3 ihfB Integration host factor subunit beta Chelativorans sp. (strain BNC1)
Q1QS30 2.01e-26 96 49 0 91 3 ihfB Integration host factor subunit beta Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A8LSF5 2.57e-26 95 48 0 91 3 ihfB Integration host factor subunit beta Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q3SWL5 3.54e-26 95 49 0 91 3 ihfB Integration host factor subunit beta Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q06607 4.44e-26 95 50 0 91 1 ihfB Integration host factor subunit beta Rhodobacter capsulatus
B9JZH2 8.41e-26 94 49 0 91 3 ihfB Integration host factor subunit beta Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A1B8K9 8.84e-26 94 48 0 91 3 ihfB Integration host factor subunit beta Paracoccus denitrificans (strain Pd 1222)
B2IKV6 9.25e-26 94 48 0 91 3 ihfB Integration host factor subunit beta Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A7HPD7 9.79e-26 94 50 0 91 3 ihfB Integration host factor subunit beta Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q2J2G1 9.9e-26 94 48 0 91 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain HaA2)
B3Q602 1.04e-25 94 48 0 91 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain TIE-1)
Q6NDN9 1.04e-25 94 48 0 91 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q13EQ5 1.33e-25 94 48 0 91 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisB5)
Q8UIF9 1.44e-25 94 50 0 91 3 ihfB Integration host factor subunit beta Agrobacterium fabrum (strain C58 / ATCC 33970)
Q89WE8 2.02e-25 94 49 0 91 3 ihfB Integration host factor subunit beta Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q92SJ7 2.68e-25 93 49 0 91 3 ihfB Integration host factor subunit beta Rhizobium meliloti (strain 1021)
B5ZN05 3.02e-25 93 49 0 91 3 ihfB Integration host factor subunit beta Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MM94 3.02e-25 93 49 0 91 3 ihfB Integration host factor subunit beta Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2KD65 3.02e-25 93 49 0 91 3 ihfB Integration host factor subunit beta Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PZE1 3.02e-25 93 49 0 91 3 ihfB Integration host factor subunit beta Rhizobium etli (strain CIAT 652)
A5E8A7 3.3e-25 93 48 0 91 3 ihfB Integration host factor subunit beta Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B9J885 3.39e-25 93 49 0 91 3 ihfB Integration host factor subunit beta Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A6U5F1 3.41e-25 93 49 0 91 3 ihfB Integration host factor subunit beta Sinorhizobium medicae (strain WSM419)
Q21CB6 3.44e-25 93 48 0 91 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisB18)
A4YJI9 4.54e-25 93 48 0 91 3 ihfB Integration host factor subunit beta Bradyrhizobium sp. (strain ORS 278)
P0A3I1 2.1e-21 83 43 0 91 3 ihfB Integration host factor subunit beta Rhizobium radiobacter
P0A3I2 2.1e-21 83 43 0 91 3 ihfB Integration host factor subunit beta Agrobacterium tumefaciens (strain 15955)
P08821 3.81e-20 80 42 1 88 1 hbs DNA-binding protein HU 1 Bacillus subtilis (strain 168)
Q7A0U9 4.2e-20 80 42 1 88 3 hup DNA-binding protein HU Staphylococcus aureus (strain MW2)
Q6G990 4.2e-20 80 42 1 88 3 hup DNA-binding protein HU Staphylococcus aureus (strain MSSA476)
Q6GGT8 4.2e-20 80 42 1 88 3 hup DNA-binding protein HU Staphylococcus aureus (strain MRSA252)
Q7A5J1 4.2e-20 80 42 1 88 1 hup DNA-binding protein HU Staphylococcus aureus (strain N315)
Q99U17 4.2e-20 80 42 1 88 1 hup DNA-binding protein HU Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFV0 4.2e-20 80 42 1 88 3 hup DNA-binding protein HU Staphylococcus aureus (strain COL)
Q9KDA5 6.1e-20 79 40 1 91 3 hup1 DNA-binding protein HU-1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KQS9 7.42e-20 79 38 1 91 3 hupB DNA-binding protein HU-beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A3H0 4.8e-19 77 42 1 88 1 hup DNA-binding protein HU Geobacillus stearothermophilus
P0A3H1 4.8e-19 77 42 1 88 1 hup DNA-binding protein HU Bacillus caldolyticus
P0A3H2 4.8e-19 77 42 1 88 3 hup DNA-binding protein HU Bacillus caldotenax
P05384 6.52e-19 77 37 1 91 1 hupB DNA-binding protein HU-beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9K7K5 1.6e-18 75 38 1 88 3 hup2 DNA-binding protein HU-1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P05385 3.64e-18 75 41 1 91 1 hup DNA-binding protein HU Clostridium pasteurianum
P0A1R8 8.3e-18 74 36 1 91 3 hupB DNA-binding protein HU-beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R9 8.3e-18 74 36 1 91 3 hupB DNA-binding protein HU-beta Salmonella typhi
P52681 8.39e-18 74 34 1 91 3 hupB DNA-binding protein HU-beta Serratia marcescens
Q9XB21 1.26e-17 73 40 1 86 1 hup DNA-binding protein HU Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P0ACF7 1.8e-17 73 35 1 91 3 hupB DNA-binding protein HU-beta Shigella flexneri
P0ACF4 1.8e-17 73 35 1 91 1 hupB DNA-binding protein HU-beta Escherichia coli (strain K12)
P0ACF5 1.8e-17 73 35 1 91 3 hupB DNA-binding protein HU-beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACF6 1.8e-17 73 35 1 91 3 hupB DNA-binding protein HU-beta Escherichia coli O157:H7
P28080 1.94e-17 73 35 1 88 3 hupA DNA-binding protein HU-alpha Vibrio proteolyticus
Q9LA96 2.24e-17 73 36 2 90 3 hupA DNA-binding protein HU-alpha Aeromonas hydrophila
P68574 2.41e-17 73 39 1 88 3 hup2 DNA-binding protein HU 2 Bacillus phage SPbeta
P68573 2.41e-17 73 39 1 88 3 hup2 SPbeta prophage-derived DNA-binding protein HU 2 Bacillus subtilis (strain 168)
Q8KA69 3.47e-17 72 37 1 88 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9KHS6 4.81e-17 72 37 1 91 3 hupB DNA-binding protein HU-beta Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9KV83 8.21e-17 71 36 1 88 3 hupA DNA-binding protein HU-alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0C0H2 9.92e-17 71 40 1 86 3 hup DNA-binding protein HU Streptococcus pyogenes
P0DB65 9.92e-17 71 40 1 86 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M3 (strain SSI-1)
P0C097 9.92e-17 71 40 1 86 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XB35 9.92e-17 71 40 1 86 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DB64 9.92e-17 71 40 1 86 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0H3 9.92e-17 71 40 1 86 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M1
Q21KD4 1.58e-16 71 37 1 94 3 ihfA Integration host factor subunit alpha Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P43722 1.84e-16 70 36 1 88 3 hup DNA-binding protein HU Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P96045 2.59e-16 70 40 1 86 3 hup DNA-binding protein HU Streptococcus thermophilus
P29214 2.88e-16 70 37 1 91 3 hup DNA-binding protein HU homolog Guillardia theta
P0ACF3 4.26e-16 69 34 1 88 3 hupA DNA-binding protein HU-alpha Shigella flexneri
E0J6W8 4.26e-16 69 34 1 88 1 hupA DNA-binding protein HU-alpha Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)
P0ACF0 4.26e-16 69 34 1 88 1 hupA DNA-binding protein HU-alpha Escherichia coli (strain K12)
P0ACF1 4.26e-16 69 34 1 88 3 hupA DNA-binding protein HU-alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACF2 4.26e-16 69 34 1 88 3 hupA DNA-binding protein HU-alpha Escherichia coli O157:H7
Q9CK94 5.47e-16 69 36 1 88 3 hup DNA-binding protein HU Pasteurella multocida (strain Pm70)
P0A1R6 5.84e-16 69 34 1 88 3 hupA DNA-binding protein HU-alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R7 5.84e-16 69 34 1 88 3 hupA DNA-binding protein HU-alpha Salmonella typhi
Q87E48 9.07e-16 69 37 1 88 3 hup DNA-binding protein HU Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P64389 1.54e-15 68 37 1 88 3 hupB DNA-binding protein HU-beta Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64388 1.54e-15 68 37 1 88 3 hupB DNA-binding protein HU-beta Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q1GI70 1.6e-15 68 37 1 90 3 ihfA Integration host factor subunit alpha Ruegeria sp. (strain TM1040)
Q9XB22 1.73e-15 68 38 1 86 3 hup DNA-binding protein HU Streptococcus downei
Q9CI64 2.22e-15 68 41 1 86 1 hup DNA-binding protein HU Lactococcus lactis subsp. lactis (strain IL1403)
A7HBJ3 2.38e-15 68 35 1 92 3 ihfA Integration host factor subunit alpha Anaeromyxobacter sp. (strain Fw109-5)
Q28RG2 2.55e-15 68 41 0 67 3 ihfA Integration host factor subunit alpha Jannaschia sp. (strain CCS1)
Q6MMJ0 3.81e-15 68 34 1 91 3 ihfA Integration host factor subunit alpha Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q2IJA7 3.84e-15 68 36 1 91 3 ihfA Integration host factor subunit alpha Anaeromyxobacter dehalogenans (strain 2CP-C)
P19436 3.86e-15 67 34 1 89 1 TTHA1349 DNA-binding protein HU Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
B4UAP1 4.23e-15 67 36 1 91 3 ihfA Integration host factor subunit alpha Anaeromyxobacter sp. (strain K)
B8J836 4.23e-15 67 36 1 91 3 ihfA Integration host factor subunit alpha Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
P52680 4.29e-15 67 32 1 88 3 hupA DNA-binding protein HU-alpha Serratia marcescens
P57144 4.37e-15 67 32 1 88 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P02348 4.45e-15 67 36 1 91 1 None DNA-binding protein HRL53 Rhizobium leguminosarum
A8I5K8 4.61e-15 67 39 1 91 3 ihfA Integration host factor subunit alpha Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q4ZUG1 4.9e-15 67 36 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas syringae pv. syringae (strain B728a)
Q883H6 4.9e-15 67 36 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KEX6 4.9e-15 67 36 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain Pf0-1)
C3JZN1 4.9e-15 67 36 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain SBW25)
Q4KEV8 4.9e-15 67 36 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48JR7 4.9e-15 67 36 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9CN18 5.37e-15 67 40 1 90 3 ihfA Integration host factor subunit alpha Pasteurella multocida (strain Pm70)
Q31F20 5.41e-15 67 35 1 94 3 ihfA Integration host factor subunit alpha Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P43723 5.45e-15 67 37 1 90 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKM2 5.45e-15 67 37 1 90 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain 86-028NP)
Q0AAM1 6.24e-15 67 35 1 94 3 ihfA Integration host factor subunit alpha Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1IC09 6.29e-15 67 36 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas entomophila (strain L48)
Q1GT91 8e-15 66 35 1 89 3 ihfA Integration host factor subunit alpha Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A5VC87 8.72e-15 66 48 0 64 3 ihfA Integration host factor subunit alpha Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A6VP80 8.76e-15 66 39 1 89 3 ihfA Integration host factor subunit alpha Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9JR30 8.94e-15 66 37 1 91 3 hupB2 DNA-binding protein HU-beta 2 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q3JBZ6 9.59e-15 66 36 1 94 3 ihfA Integration host factor subunit alpha Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q9PE38 1.01e-14 66 35 1 94 3 hup DNA-binding protein HU Xylella fastidiosa (strain 9a5c)
P0DMK4 1.27e-14 66 36 1 91 3 hupA DNA-binding protein HU-alpha Burkholderia pseudomallei (strain K96243)
I1WEI8 1.27e-14 66 36 1 91 3 hupA DNA-binding protein HU-alpha Burkholderia pseudomallei (strain 1026b)
A7INL3 1.31e-14 66 39 1 91 3 ihfA Integration host factor subunit alpha Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
P30787 1.39e-14 66 36 1 90 1 ihfA Integration host factor subunit alpha Rhodobacter capsulatus
Q5GXY6 1.51e-14 66 34 1 94 3 ihfA Integration host factor subunit alpha Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P101 1.51e-14 66 34 1 94 3 ihfA Integration host factor subunit alpha Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BRU3 1.51e-14 66 34 1 94 3 ihfA Integration host factor subunit alpha Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P0A0T9 1.51e-14 66 34 1 94 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RRH5 1.51e-14 66 34 1 94 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain B100)
Q4UW51 1.51e-14 66 34 1 94 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain 8004)
P0A0U0 1.51e-14 66 34 1 94 3 ihfA Integration host factor subunit alpha Xanthomonas axonopodis pv. citri (strain 306)
A5UF06 1.64e-14 65 37 1 90 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain PittGG)
B2FN73 1.69e-14 65 35 1 94 3 ihfA Integration host factor subunit alpha Stenotrophomonas maltophilia (strain K279a)
B4SQG8 1.69e-14 65 35 1 94 3 ihfA Integration host factor subunit alpha Stenotrophomonas maltophilia (strain R551-3)
A5EXT4 1.74e-14 65 35 1 89 3 ihfA Integration host factor subunit alpha Dichelobacter nodosus (strain VCS1703A)
B6EN06 1.82e-14 65 37 1 89 3 ihfA Integration host factor subunit alpha Aliivibrio salmonicida (strain LFI1238)
B5FDX6 1.92e-14 65 37 1 89 3 ihfA Integration host factor subunit alpha Aliivibrio fischeri (strain MJ11)
Q5E5G4 1.92e-14 65 37 1 89 3 ihfA Integration host factor subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q9F297 2.1e-14 65 39 0 87 3 ihfA Integration host factor subunit alpha (Fragment) Neisseria gonorrhoeae
Q89B22 2.26e-14 65 33 1 87 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1KSZ1 2.48e-14 65 37 0 93 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P64393 2.48e-14 65 37 0 93 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64392 2.48e-14 65 37 0 93 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M383 2.48e-14 65 37 0 93 3 ihfA Integration host factor subunit alpha Neisseria meningitidis serogroup C (strain 053442)
Q5LQJ4 2.73e-14 65 36 1 90 3 ihfA Integration host factor subunit alpha Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9PFD5 2.78e-14 65 32 1 94 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain 9a5c)
Q2SDJ8 2.88e-14 65 32 1 94 3 ihfA Integration host factor subunit alpha Hahella chejuensis (strain KCTC 2396)
B4RJZ4 3.11e-14 65 39 0 87 3 ihfA Integration host factor subunit alpha Neisseria gonorrhoeae (strain NCCP11945)
Q5F9T5 3.11e-14 65 39 0 87 3 ihfA Integration host factor subunit alpha Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B0BNN9 3.13e-14 65 40 1 90 3 ihfA Integration host factor subunit alpha Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H139 3.13e-14 65 40 1 90 3 ihfA Integration host factor subunit alpha Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZX6 3.13e-14 65 40 1 90 3 ihfA Integration host factor subunit alpha Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P02344 3.36e-14 65 36 1 91 1 hupB DNA-binding protein HRm Rhizobium meliloti (strain 1021)
A3QF32 3.56e-14 65 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B1ZKI7 3.99e-14 65 37 1 91 3 ihfA Integration host factor subunit alpha Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A1S700 4.24e-14 65 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B1J6V0 4.41e-14 65 35 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain W619)
P0A127 4.41e-14 65 35 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas putida
P0A126 4.41e-14 65 35 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KKR2 4.41e-14 65 35 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain GB-1)
A5W5D5 4.41e-14 65 35 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q87AB7 4.79e-14 64 32 1 94 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5D7 4.79e-14 64 32 1 94 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain M12)
B2I9P2 4.79e-14 64 32 1 94 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain M23)
Q12NT8 4.95e-14 64 37 1 89 3 ihfA Integration host factor subunit alpha Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q45722 5.24e-14 65 34 2 95 3 hbb DNA-binding protein HBbu Borrelia turicatae
B7V312 5.6e-14 64 35 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain LESB58)
A1RK12 5.69e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain W3-18-1)
A4Y6H0 5.69e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KYZ2 5.69e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS195)
A6WMK6 5.69e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS185)
A3D3R8 5.69e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E7F3 5.69e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella baltica (strain OS223)
Q45352 6.3e-14 64 35 2 93 3 hbb DNA-binding protein HBbu Borrelia parkeri
A8FWI0 6.41e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella sediminis (strain HAW-EB3)
B8CR59 6.41e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H5F1 6.41e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TQY4 6.41e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella halifaxensis (strain HAW-EB4)
Q0VNG4 6.44e-14 64 34 1 94 3 ihfA Integration host factor subunit alpha Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q083K5 6.5e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella frigidimarina (strain NCIMB 400)
Q0HUQ0 6.77e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain MR-7)
Q0HJ83 6.77e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain MR-4)
B1KRE5 6.97e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella woodyi (strain ATCC 51908 / MS32)
A0KWC7 6.99e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella sp. (strain ANA-3)
Q8EF98 7.22e-14 64 35 1 89 3 ihfA Integration host factor subunit alpha Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q47ZS6 9.98e-14 63 34 1 90 3 ihfA Integration host factor subunit alpha Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
P36206 1.02e-13 63 38 1 91 1 hup DNA-binding protein HU Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q2N927 1.04e-13 63 38 1 89 3 ihfA Integration host factor subunit alpha Erythrobacter litoralis (strain HTCC2594)
B8GRI6 1.16e-13 63 34 1 93 3 ihfA Integration host factor subunit alpha Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A4VM16 1.18e-13 63 35 1 94 3 ihfA Integration host factor subunit alpha Stutzerimonas stutzeri (strain A1501)
A1WU59 1.2e-13 63 34 1 94 3 ihfA Integration host factor subunit alpha Halorhodospira halophila (strain DSM 244 / SL1)
Q51472 1.24e-13 63 35 1 94 1 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02NN5 1.24e-13 63 35 1 94 1 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V491 1.24e-13 63 35 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas aeruginosa (strain PA7)
A1B366 1.26e-13 63 35 1 90 3 ihfA Integration host factor subunit alpha Paracoccus denitrificans (strain Pd 1222)
C3LLR8 1.37e-13 63 35 1 89 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain M66-2)
Q9KSN4 1.37e-13 63 35 1 89 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1W7 1.37e-13 63 35 1 89 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4XTS7 1.54e-13 63 35 1 94 3 ihfA Integration host factor subunit alpha Pseudomonas mendocina (strain ymp)
A4WTU0 1.59e-13 63 33 1 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3J366 1.59e-13 63 33 1 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PJ63 1.59e-13 63 33 1 89 3 ihfA Integration host factor subunit alpha Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A1U2B7 1.61e-13 63 31 1 94 3 ihfA Integration host factor subunit alpha Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A9W4E5 1.71e-13 63 36 1 91 3 ihfA Integration host factor subunit alpha Methylorubrum extorquens (strain PA1)
B7KYG6 1.71e-13 63 36 1 91 3 ihfA Integration host factor subunit alpha Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A8LLT5 1.98e-13 63 40 0 67 3 ihfA Integration host factor subunit alpha Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B4ETL2 2.87e-13 62 33 1 89 3 ihfA Integration host factor subunit alpha Proteus mirabilis (strain HI4320)
Q2NT26 3.45e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Sodalis glossinidius (strain morsitans)
Q5QXL9 3.61e-13 62 38 2 92 3 ihfA Integration host factor subunit alpha Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A7MVH4 3.65e-13 62 35 1 89 3 ihfA Integration host factor subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
C6DFZ2 3.65e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4H4 3.65e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TAI1 3.69e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XQD2 3.69e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Klebsiella pneumoniae (strain 342)
P37982 3.99e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Dickeya dadantii (strain 3937)
B2VEL2 4.03e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8A0Q4 4.03e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O9:H4 (strain HS)
A4W9M9 4.07e-13 62 35 1 89 3 ihfA Integration host factor subunit alpha Enterobacter sp. (strain 638)
Q3Z260 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Shigella sonnei (strain Ss046)
P0A6Y0 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Shigella flexneri
Q0T4S2 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Shigella flexneri serotype 5b (strain 8401)
Q32FI7 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Shigella dysenteriae serotype 1 (strain Sd197)
Q321K4 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Shigella boydii serotype 4 (strain Sb227)
B2U390 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LQ77 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RB83 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain UTI89 / UPEC)
B1LE18 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain SMS-3-5 / SECEC)
B6I8Q5 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain SE11)
B7N550 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6X7 4.12e-13 62 35 1 90 1 ihfA Integration host factor subunit alpha Escherichia coli (strain K12)
B1IPL5 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6X8 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THB6 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1XG19 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain K12 / DH10B)
C4ZYH4 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1C1 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O8 (strain IAI1)
B7MVJ1 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O81 (strain ED1a)
B7NT64 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQ00 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6X9 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O157:H7
B7L6I5 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain 55989 / EAEC)
B7MAS3 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O45:K1 (strain S88 / ExPEC)
B7US95 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZMI0 4.12e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MNY7 4.21e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
A9MFB7 4.35e-13 62 35 1 89 3 ihfA Integration host factor subunit alpha Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q87Q56 4.73e-13 62 35 1 89 3 ihfA Integration host factor subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P0A1S0 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1S1 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella typhi
B4TUF6 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella schwarzengrund (strain CVM19633)
B5BA36 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella paratyphi A (strain AKU_12601)
C0Q640 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella paratyphi C (strain RKS4594)
A9N236 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PH86 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4N4 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella newport (strain SL254)
B4TGH7 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella heidelberg (strain SL476)
B5RAW7 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW2 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella enteritidis PT4 (strain P125109)
B5FJA2 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella dublin (strain CT_02021853)
Q57PU7 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella choleraesuis (strain SC-B67)
B5F7F6 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Salmonella agona (strain SL483)
A8AHA5 4.79e-13 62 35 1 90 3 ihfA Integration host factor subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q1D6D8 5.02e-13 63 34 1 91 3 ihfA Integration host factor subunit alpha Myxococcus xanthus (strain DK1622)
Q9K4Q3 5.02e-13 63 34 1 91 3 ihfA Integration host factor subunit alpha Myxococcus xanthus
Q3IIL3 5.17e-13 62 33 1 92 3 ihfA Integration host factor subunit alpha Pseudoalteromonas translucida (strain TAC 125)
Q5HUP6 5.33e-13 62 35 1 88 3 hup DNA-binding protein HU Campylobacter jejuni (strain RM1221)
Q46121 5.33e-13 62 35 1 88 1 hup DNA-binding protein HU Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q15SX9 6.01e-13 62 33 1 89 3 ihfA Integration host factor subunit alpha Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q7N3Q2 6.27e-13 62 33 1 90 3 ihfA Integration host factor subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q5ZS10 6.5e-13 62 34 1 89 3 ihfA Integration host factor subunit alpha Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WT88 6.68e-13 62 34 1 89 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Lens)
A5IAL5 6.68e-13 62 34 1 89 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Corby)
Q5X1H9 6.68e-13 62 34 1 89 3 ihfA Integration host factor subunit alpha Legionella pneumophila (strain Paris)
Q7MK44 7.09e-13 61 33 1 90 3 ihfA Integration host factor subunit alpha Vibrio vulnificus (strain YJ016)
Q8DA35 7.09e-13 61 33 1 90 3 ihfA Integration host factor subunit alpha Vibrio vulnificus (strain CMCP6)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_03805
Feature type CDS
Gene ihfB
Product integration host factor subunit beta
Location 79736 - 80020 (strand: -1)
Length 285 (nucleotides) / 94 (amino acids)

Contig

Accession ZDB_520
Length 336657 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1230
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00216 Bacterial DNA-binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0776 Replication, recombination and repair (L) L Bacterial nucleoid DNA-binding protein IHF-alpha

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05788 integration host factor subunit beta - -

Protein Sequence

MTKSELIEKLAGQQSHLPAKVVEEAVKEILEHMANTLADGERIEIRGFGSFSLHYRAPRVGRNPKTGEQVELEGKHVPHFKPGKELRDRANIYA

Flanking regions ( +/- flanking 50bp)

CCGCGCAAGCGGTCTGCTTTTATGATAATCAGGGTAGTCCAGGAGGTTATATGACCAAATCTGAACTGATTGAGAAGCTGGCAGGCCAACAATCTCATCTTCCGGCTAAAGTTGTTGAAGAAGCAGTAAAAGAGATCCTTGAGCATATGGCAAATACGCTTGCTGACGGCGAACGTATTGAAATCCGTGGATTCGGCAGTTTTTCTCTGCACTACCGTGCACCGCGGGTAGGTCGTAACCCGAAAACCGGCGAACAGGTGGAACTGGAAGGTAAACACGTTCCTCACTTCAAACCGGGCAAAGAGTTACGCGACCGCGCAAATATCTATGCTTGATTATTGACAGAGATAATAAAAATGACGCCACCGGCGTCATTTTTTTTGCA