Homologs in group_98

Help

11 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14705 FBDBKF_14705 100.0 Morganella morganii S1 fabF beta-ketoacyl-ACP synthase II
EHELCC_15510 EHELCC_15510 100.0 Morganella morganii S2 fabF beta-ketoacyl-ACP synthase II
NLDBIP_16040 NLDBIP_16040 100.0 Morganella morganii S4 fabF beta-ketoacyl-ACP synthase II
HKOGLL_14920 HKOGLL_14920 100.0 Morganella morganii S5 fabF beta-ketoacyl-ACP synthase II
F4V73_RS07500 F4V73_RS07500 93.2 Morganella psychrotolerans fabF beta-ketoacyl-ACP synthase II
F4V73_RS12000 F4V73_RS12000 31.5 Morganella psychrotolerans - beta-ketoacyl-[acyl-carrier-protein] synthase family protein
F4V73_RS12015 F4V73_RS12015 37.4 Morganella psychrotolerans - beta-ketoacyl-ACP synthase
PMI_RS03710 PMI_RS03710 16.3 Proteus mirabilis HI4320 - 3-oxoacyl-ACP synthase
PMI_RS04235 PMI_RS04235 85.2 Proteus mirabilis HI4320 fabF beta-ketoacyl-ACP synthase II
PMI_RS14370 PMI_RS14370 18.1 Proteus mirabilis HI4320 - beta-ketoacyl synthase N-terminal-like domain-containing protein
PMI_RS14375 PMI_RS14375 35.3 Proteus mirabilis HI4320 - beta-ketoacyl-[acyl-carrier-protein] synthase family protein

Distribution of the homologs in the orthogroup group_98

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_98

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AAI8 0.0 656 84 3 415 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Shigella flexneri
P0AAI5 0.0 656 84 3 415 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Escherichia coli (strain K12)
P0AAI6 0.0 656 84 3 415 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAI7 0.0 656 84 3 415 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Escherichia coli O157:H7
Q9KQH9 0.0 629 73 3 416 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P55338 0.0 618 73 4 416 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Vibrio harveyi
Q83E37 4.25e-173 493 56 4 415 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
O34340 3.89e-151 437 53 5 414 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Bacillus subtilis (strain 168)
P73283 2.2e-139 407 49 4 414 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8NXE1 7.43e-134 393 49 5 412 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain MW2)
Q6GAU2 7.43e-134 393 49 5 412 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain MSSA476)
Q5HHA1 7.43e-134 393 49 5 412 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain COL)
Q6GIA3 2.28e-133 392 49 5 411 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain MRSA252)
Q7A6F8 2.57e-133 392 48 5 412 1 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain N315)
Q99VA6 2.57e-133 392 48 5 412 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5TKS0 9.01e-131 385 48 5 407 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) Staphylococcus aureus
P56902 1.81e-129 382 50 8 420 3 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Rhizobium meliloti (strain 1021)
Q9D404 2.75e-118 355 47 7 419 1 Oxsm 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Mus musculus
Q8L3X9 8.48e-118 353 46 8 434 1 KAS 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Arabidopsis thaliana
P52410 7.79e-117 352 44 4 412 1 KAS1 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic Arabidopsis thaliana
Q9NWU1 2.92e-116 350 47 7 417 1 OXSM 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Homo sapiens
P23902 3.17e-110 334 43 4 414 1 KAS12 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic Hordeum vulgare
O94297 5.55e-110 332 43 8 425 3 SPBC887.13c Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q0VCA7 8.29e-108 328 46 7 417 2 OXSM 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Bos taurus
Q9C9P4 2.63e-105 324 45 5 413 1 KAS2 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic Arabidopsis thaliana
P39525 6.69e-99 305 39 7 442 1 CEM1 3-oxoacyl-[acyl-carrier-protein] synthase homolog Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P9WQD9 1.47e-88 277 41 7 393 1 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQD8 1.47e-88 277 41 7 393 3 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
H8ESN0 1.47e-88 277 41 7 393 2 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)
P63455 1.47e-88 277 41 7 393 3 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P43710 4.02e-88 276 41 9 414 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CBS7 5.65e-87 273 40 6 393 3 kasA 3-oxoacyl-[acyl-carrier-protein] synthase 1 Mycobacterium leprae (strain TN)
Q05356 9.43e-84 265 36 7 419 3 sch1 Putative polyketide beta-ketoacyl synthase 1 Streptomyces halstedii
P9WQD7 2.93e-82 261 37 8 410 1 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQD6 2.93e-82 261 37 8 410 3 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63457 2.93e-82 261 37 8 410 3 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P23155 4.91e-82 261 35 7 422 3 SCO5318 Putative polyketide beta-ketoacyl synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O69473 1.72e-80 256 36 8 410 3 kasB 3-oxoacyl-[acyl-carrier-protein] synthase 2 Mycobacterium leprae (strain TN)
P72331 2e-80 256 38 6 413 3 nodE Nodulation protein E Rhizobium sp. (strain N33)
P04684 2.63e-80 256 39 6 413 3 nodE Nodulation protein E Rhizobium leguminosarum bv. trifolii
Q02578 5.33e-80 255 36 6 419 3 curA Putative polyketide beta-ketoacyl synthase 1 Streptomyces cyaneus
P16538 2.71e-79 254 35 6 423 1 tcmK Tetracenomycin polyketide synthase ketoacyl synthase alpha subunit Streptomyces glaucescens
P16540 2.76e-79 253 35 5 417 3 gra-orf1 Granaticin polyketide putative beta-ketoacyl synthase 1 Streptomyces violaceoruber
P06230 1.27e-77 249 37 8 415 3 nodE Nodulation protein E Rhizobium meliloti (strain 1021)
Q02059 8.28e-77 248 36 6 421 1 SCO5087 Actinorhodin polyketide putative beta-ketoacyl synthase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q02K94 1.21e-76 246 38 8 411 1 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
P06231 2.09e-75 243 37 8 414 3 nodE Nodulation protein E Rhizobium meliloti
Q89AY4 6.65e-74 239 36 9 419 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P04683 1.48e-72 236 37 6 413 3 nodE Nodulation protein E Rhizobium leguminosarum bv. viciae
P0A953 9.49e-72 234 38 12 417 1 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Escherichia coli (strain K12)
P0A954 9.49e-72 234 38 12 417 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P57193 1.47e-71 233 37 12 416 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P41175 1.7e-71 233 35 8 418 3 None Putative polyketide beta-ketoacyl synthase 1 Streptomyces virginiae
P43678 3.17e-62 209 34 7 419 3 None Oxytetracycline polyketide putative beta-ketoacyl synthase 1 Streptomyces rimosus
Q8KA28 8.1e-57 195 33 8 419 3 fabB 3-oxoacyl-[acyl-carrier-protein] synthase 1 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P16539 8.45e-45 163 30 7 409 1 tcmL Tetracenomycin polyketide synthase ketoacyl synthase beta subunit Streptomyces glaucescens
I6X8D2 1.06e-42 164 29 6 421 1 pks13 Polyketide synthase Pks13 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q02062 2.21e-38 145 28 9 412 1 SCO5088 Actinorhodin polyketide putative beta-ketoacyl synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A0A0B5KU17 9.23e-34 137 27 11 429 1 mpaC' Non-reducing polyketide synthase mapC' Penicillium brevicompactum
Q0C8A4 1.12e-32 134 26 11 433 1 trt4 Non-reducing polyketide synthase trt4 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q5KTM9 5.31e-32 132 28 5 376 1 alt5 Highly reducing polyketide synthase alt5 Alternaria solani
Q84HC6 5.4e-32 132 27 11 418 1 ncsB Neocarzinostatin naphthoate synthase Streptomyces carzinostaticus
P40804 5.68e-32 128 29 9 357 1 pksF Polyketide biosynthesis malonyl-ACP decarboxylase PksF Bacillus subtilis (strain 168)
A0A0Y0M151 8.62e-32 132 28 8 368 1 cla2 Highly reducing polyketide synthase cla2 Cladosporium cladosporioides
Q02251 1.03e-31 131 27 9 426 1 mas Mycocerosic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7TXM0 1.81e-31 130 26 9 438 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
F1DBA9 1.93e-31 130 27 14 432 1 mpaC Non-reducing polyketide synthase mapC Penicillium brevicompactum
P41176 2.24e-31 126 28 9 410 3 None Putative polyketide beta-ketoacyl synthase 2 Streptomyces virginiae
P9WQE7 2.37e-31 130 26 9 438 1 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE6 2.73e-31 130 26 9 438 3 ppsA Phenolphthiocerol/phthiocerol polyketide synthase subunit A Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0A0U5GFS8 4.31e-31 129 26 12 439 1 ausA Non-reducing polyketide synthase ausA Aspergillus calidoustus
Q5ATJ7 6.04e-31 129 25 11 434 1 ausA Non-reducing polyketide synthase ausA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q7TXL9 9.87e-31 128 27 13 438 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQE5 1.02e-30 128 27 13 438 1 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE4 1.02e-30 128 27 13 438 3 ppsB Phenolphthiocerol/phthiocerol polyketide synthase subunit B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q869W9 1.32e-30 128 25 11 435 2 pks16 Probable polyketide synthase 16 Dictyostelium discoideum
A0A0A0RM07 2.04e-30 127 28 9 380 1 MLNS Mellein synthase Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
I6XD69 2.13e-30 127 27 7 382 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
I6XD69 9.09e-27 117 25 11 448 1 pks12 Mycoketide-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0A1L7U4V5 2.73e-30 127 27 6 389 2 FMN1 Reducing polyketide synthase 8 Fusarium mangiferae
Q5ATG8 4.38e-30 127 26 9 379 1 apdA Hybrid PKS-NRPS synthetase apdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A097ZPE0 1.41e-29 125 24 11 429 1 andM Non-reducing polyketide synthase andM Emericella variicolor
C8VJR7 1.84e-29 125 28 6 364 1 alnA Highly reducing polyketide synthase alnA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A0R8YWJ7 1.95e-29 124 25 11 426 1 mpas Methylphloroacetophenone synthase Cladonia uncialis
A0A5C1RD96 2.04e-29 124 26 11 432 3 pksAC Non-reducing polyketide synthase AC Didymella fabae
P9WET6 2.53e-29 124 27 13 437 1 Preu3 Non-reducing polyketide synthase Preu3 Preussia isomera
O31782 4.58e-29 124 27 13 450 1 pksN Polyketide synthase PksN Bacillus subtilis (strain 168)
O31782 1.34e-26 116 26 12 457 1 pksN Polyketide synthase PksN Bacillus subtilis (strain 168)
O31782 3.34e-20 97 27 11 367 1 pksN Polyketide synthase PksN Bacillus subtilis (strain 168)
Q869X2 6.55e-29 123 25 12 435 3 pks17 Probable polyketide synthase 17 Dictyostelium discoideum
A0A0F7U103 6.56e-29 123 25 12 434 3 ausA Non-reducing polyketide synthase ausA Penicillium brasilianum
A0A1E1FFN8 7.4e-29 123 25 12 434 3 prhL Non-reducing polyketide synthase prhL Penicillium brasilianum
Q9ZGI4 8.37e-29 123 25 12 443 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q9ZGI4 1.31e-28 122 26 8 375 1 pikAII Narbonolide/10-deoxymethynolide synthase PikA2, modules 3 and 4 Streptomyces venezuelae
Q9ZGI5 1.51e-28 122 27 7 370 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 2.39e-28 121 24 11 440 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q9ZGI5 6.38e-26 114 25 13 443 1 pikAI Narbonolide/10-deoxymethynolide synthase PikA1, modules 1 and 2 Streptomyces venezuelae
Q55E72 1.83e-28 122 25 11 458 1 stlA Probable polyketide synthase 1 Dictyostelium discoideum
A0R1E8 1.98e-28 121 25 9 424 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B3FWU0 2.16e-28 121 27 9 374 1 rdc5 Reducing polyketide synthase rdc5 Metacordyceps chlamydosporia
Q2T4N1 2.27e-28 121 25 9 385 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N1 1.04e-24 110 27 13 440 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N1 1.28e-21 101 25 12 446 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N1 1.64e-21 101 25 10 428 2 thaG Polyketide synthase ThaG Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P0CU67 3.68e-28 120 24 13 444 1 claG Atrochrysone carboxylic acid synthase Passalora fulva
B1GVX7 5.86e-28 120 28 10 399 2 BOA6 Reducing polyketide synthase BOA6 Botryotinia fuckeliana (strain B05.10)
A0A089QRB9 8.98e-28 119 24 10 438 1 msl3 Mycolipanoate synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P16541 9.18e-28 117 28 9 393 3 gra-orf2 Granaticin polyketide putative beta-ketoacyl synthase 2 Streptomyces violaceoruber
A0A481WQB6 9.64e-28 119 25 12 447 1 claF Clavatol synthase claF Penicillium crustosum
B6HV32 1.18e-27 119 26 12 435 1 adrD Non-reducing polyketide synthase adrD Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
P96284 1.19e-27 117 27 14 439 1 pks15 Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
C5FM57 1.25e-27 119 25 14 447 3 nscA Non-reducing polyketide synthase nscA Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)
P96202 1.56e-27 119 25 12 451 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7TXL8 1.56e-27 119 25 12 451 1 ppsC Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
W6QL47 1.61e-27 119 27 8 368 3 mpaC Non-reducing polyketide synthase mapC Penicillium roqueforti (strain FM164)
G4MVZ2 2.05e-27 119 26 13 453 1 ACE1 Polyketide synthase-nonribosomal peptide synthetase ACE1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
P23156 2.61e-27 115 27 9 413 3 SCO5317 Putative polyketide beta-ketoacyl synthase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A0A098D8A0 2.63e-27 118 28 7 369 2 ZEA2 Highly reducing polyketide synthase ZEA2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
B6HNK3 2.85e-27 118 27 5 365 3 sorA Highly reducing polyketide synthase sorA Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
Q02579 3.86e-27 115 28 11 415 3 curB Putative polyketide beta-ketoacyl synthase 2 Streptomyces cyaneus
A0A0B4I1J8 4.52e-27 117 26 10 391 2 Pks2 Polyketide synthase 2 Metarhizium majus (strain ARSEF 297)
Q7TXK8 5.04e-27 117 26 13 439 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
E4V2N2 7.75e-27 117 25 15 448 3 nscA Non-reducing polyketide synthase nscA Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893)
Q5B7U4 7.84e-27 117 24 11 435 1 pkiA Non-reducing polyketide synthase pkiA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q05357 9.88e-27 114 28 9 415 3 sch2 Putative polyketide beta-ketoacyl synthase 2 Streptomyces halstedii
Q7TXL7 1.12e-26 116 26 14 440 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WQE3 1.19e-26 116 26 14 440 1 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit D Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE2 1.19e-26 116 26 14 440 3 ppsD Phenolphthiocerol/phthiocerol polyketide synthase subunit C Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0A7L8UVC9 1.24e-26 116 26 9 400 3 ffsA Polyketide synthase-nonribosomal peptide synthetase ffsA Aspergillus flavipes
Q0CJ59 1.34e-26 116 27 9 381 1 atX 6-methylsalicylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q5BG07 1.34e-26 116 24 13 435 1 pkdA Non-reducing polyketide synthase pkdA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q2UB00 1.35e-26 116 25 11 449 3 ppsB Reducing polyketide synthase ppsB Aspergillus oryzae (strain ATCC 42149 / RIB 40)
M3A326 1.49e-26 116 24 13 457 2 PKS8-1 Non-reducing polyketide synthase PKS8-1 Pseudocercospora fijiensis (strain CIRAD86)
A0A0U5GK88 1.57e-26 116 27 8 376 1 ausV Highly reducing polyketide synthase ausV Aspergillus calidoustus
A0A2I1BSV9 1.59e-26 116 24 12 441 1 nvfA Non-reducing polyketide synthase nvfA Aspergillus novofumigatus (strain IBT 16806)
Q03132 1.59e-26 116 24 8 434 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
Q03132 6.47e-24 108 25 10 399 1 eryA 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 Saccharopolyspora erythraea
F2PWS5 1.71e-26 115 25 14 447 3 nscA Non-reducing polyketide synthase nscA Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
B6QK76 2e-26 115 24 8 432 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN5 2e-26 115 24 8 432 3 pks11 Non-reducing polyketide synthase pks11 Talaromyces marneffei
F2S6Z9 2.05e-26 115 25 14 447 3 nscA Non-reducing polyketide synthase nscA Trichophyton tonsurans (strain CBS 112818)
D7PI15 2.18e-26 115 25 11 443 1 gsfA Non-reducing polyketide synthase gsfA Penicillium aethiopicum
Q03133 2.45e-26 115 26 10 410 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
Q03133 6.77e-15 80 23 6 388 1 eryA 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 Saccharopolyspora erythraea
Q07017 3.45e-26 115 25 7 391 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
Q07017 7.23e-26 114 26 8 376 3 orfB Oleandomycin polyketide synthase, modules 5 and 6 Streptomyces antibioticus
A0A3T0QHT6 3.53e-26 115 27 9 380 1 pvhA Hybrid PKS-NRPS synthetase pvhA Talaromyces variabilis
Q4WA61 3.63e-26 115 24 13 447 3 nscA Non-reducing polyketide synthase nscA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q5SBL6 4.13e-26 115 27 10 400 3 fsdS Fusaridione A synthetase fsdS Fusarium heterosporum
D4CZZ2 4.5e-26 114 25 14 447 3 nscA Non-reducing polyketide synthase nscA Trichophyton verrucosum (strain HKI 0517)
D4AWH3 4.92e-26 114 25 14 447 3 nscA Non-reducing polyketide synthase nscA Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
A0A0B4FLB2 5.19e-26 114 25 10 391 2 Pks2 Polyketide synthase 2 Metarhizium anisopliae (strain ARSEF 549)
A0A1Y0BRF1 5.99e-26 114 24 11 440 3 adrD Non-reducing polyketide synthase adrD Penicillium roqueforti
Q0CRQ5 7.44e-26 114 25 12 428 1 ATEG_03629 5-methylorsellinic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
E9ET39 7.65e-26 114 25 10 391 2 Pks2 Polyketide synthase 2 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q03131 1.04e-25 114 28 10 371 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
Q03131 8.66e-24 108 27 8 384 1 eryA 6-deoxyerythronolide-B synthase EryA1, modules 1 and 2 Saccharopolyspora erythraea
G3Y419 1.1e-25 113 27 6 371 1 yanA 6-methylsalicylic acid synthase Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A0A2P1DP91 1.1e-25 113 26 5 371 1 macA 6-methylsalicylic acid synthase Penicillium terrestre
A0A7L9EYL1 1.12e-25 113 28 10 378 1 xenE Hybrid PKS-NRPS synthetase xenE Xenoacremonium sinensis
M1WG96 1.15e-25 113 24 11 411 2 CPUR_05437 Non-reducing polyketide synthase CPUR_05437 Claviceps purpurea (strain 20.1)
A0A411L027 1.2e-25 113 27 11 402 3 buaA Hybrid PKS-NRPS synthetase buaA Petromyces alliaceus
D7PHZ2 1.22e-25 113 25 13 443 1 vrtA Non-reducing polyketide synthase vrtA Penicillium aethiopicum
A0A0B4I1L1 1.28e-25 113 25 10 389 2 Pks2 Polyketide synthase 2 Metarhizium guizhouense (strain ARSEF 977)
P0DO30 1.3e-25 113 25 5 385 1 iliA Hybrid PKS-NRPS synthetase iliA Neonectria sp. (strain DH2)
Q5AUX7 1.52e-25 113 24 12 431 1 dbaI Non-reducing polyketide synthase dbaI Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54T36 1.56e-25 113 23 12 453 3 pks19 Probable polyketide synthase 19 Dictyostelium discoideum
J4UHQ6 1.7e-25 113 24 12 437 1 OpS1 Orsellinic acid synthase Beauveria bassiana (strain ARSEF 2860)
A0A481WNP4 1.8e-25 113 28 8 374 3 traA Hybrid PKS-NRPS synthetase traA Penicillium crustosum
A0A067XNI2 2.01e-25 112 25 11 399 2 ptaA Non-reducing polyketide synthase ptaA Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
F2T0M0 2.13e-25 112 24 14 447 3 nscA Non-reducing polyketide synthase nscA Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
A0A482N9V7 2.54e-25 112 26 9 386 1 iccA Hybrid PKS-NRPS synthetase iccA Talaromyces variabilis
O53901 2.55e-25 112 26 8 433 1 pks5 Mycocerosic acid synthase-like polyketide synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B8MV59 2.62e-25 112 24 13 441 3 tpeA Partially reducing polyketide synthase tpeA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
B8MYS6 2.63e-25 112 23 12 445 1 pks27 Non-reducing polyketide synthase pks27 Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0A6F9DYX9 2.74e-25 112 24 13 446 1 men2 Non-reducing polyketide synthase men2 Menisporopsis theobromae
A0A455R5P9 2.77e-25 112 26 13 434 1 ascC Non-reducing polyketide synthase ascC Acremonium egyptiacum
Q05470 2.92e-25 112 25 11 422 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
Q05470 2.15e-22 103 27 9 388 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
Q05470 1.69e-19 95 24 11 450 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
Q05470 1.11e-18 92 24 8 386 1 pksL Polyketide synthase PksL Bacillus subtilis (strain 168)
Q0D1N9 3.15e-25 112 24 13 449 1 terA Non-reducing polyketide synthase terA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q54FI3 3.31e-25 112 25 8 373 1 StlB Polyketide synthase 37 Dictyostelium discoideum
A1D8I9 4.3e-25 111 24 13 447 3 nscA Non-reducing polyketide synthase nscA Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
P9WQE9 4.56e-25 111 26 11 436 1 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE8 4.56e-25 111 26 11 436 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U9F4 4.56e-25 111 26 11 436 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q7TVK8 4.56e-25 111 26 11 436 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B0G138 4.93e-25 111 22 12 456 3 pks21 Probable polyketide synthase 21 Dictyostelium discoideum
A0A0H4ADX3 5.29e-25 111 25 14 448 2 None Non-reducing polyketide synthase PKS19 Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A1B3PEI6 5.41e-25 111 26 15 467 1 ORF-A Polyunsaturated fatty acid synthase subunit A Thraustochytrium sp. (strain ATCC 26185 / S-3)
A1KQG0 6.36e-25 111 26 11 436 3 pks2 Phthioceranic/hydroxyphthioceranic acid synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
A1CFL8 7.07e-25 111 26 6 367 1 patK 6-methylcalicylic acide synthase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
B6HN77 7.08e-25 111 24 7 385 3 sorB Non-reducing polyketide synthase sorB Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
P12276 1.13e-24 110 26 9 376 1 FASN Fatty acid synthase Gallus gallus
G0REX6 1.13e-24 110 26 6 388 1 iliA Hybrid PKS-NRPS synthetase iliA Hypocrea jecorina (strain QM6a)
Q4WQZ5 1.24e-24 110 23 14 453 2 tpcC Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A193PS74 1.36e-24 110 25 12 441 1 stbA Non-reducing polyketide synthase stbA Stachybotrys bisbyi
A0A0K0MCJ4 1.39e-24 110 23 6 384 1 cazM Iterative polyketide synthase CazM Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
A0A161CEU9 1.47e-24 110 25 12 439 1 citS Citrinin polyketide synthase Monascus ruber
Q65Z23 1.47e-24 110 25 12 439 1 pksCT Citrinin polyketide synthase Monascus purpureus
A0A0S2CHA9 1.7e-24 110 23 10 433 1 pigA Non-reducing polyketide synthase pigA Monascus ruber
A0A0B4H8J1 1.89e-24 109 25 10 391 2 Pks2 Polyketide synthase 2 Metarhizium brunneum (strain ARSEF 3297)
A0A6J4B487 1.92e-24 110 24 6 378 3 LUC5 Hybrid PKS-NRPS synthetase LUC5 Fusarium sp.
Q9R9J1 1.94e-24 110 25 9 381 1 mycA Mycosubtilin synthase subunit A Bacillus subtilis
Q2ABP6 2.33e-24 109 27 8 366 1 pksF Reducing polyketide synthase pksF Alternaria solani
Q86JI5 2.48e-24 109 25 10 438 2 pks5 Probable polyketide synthase 5 Dictyostelium discoideum
Q9ZGI3 2.56e-24 109 24 7 372 1 pikAIII Narbonolide/10-deoxymethynolide synthase PikA3, module 5 Streptomyces venezuelae
A0A1L7U3D7 2.84e-24 109 30 7 289 2 FPY1 Highly reducing polyketide synthase 40 Fusarium mangiferae
A0A5C1RDA3 3.26e-24 109 25 10 431 3 orf7 Highly reducing polyketide synthase Didymella fabae
A0A2Z5TM64 3.53e-24 109 26 12 422 3 himA Polyketide synthase-nonribosomal peptide synthetase hybrid himA Aspergillus japonicus
Q0CCY3 3.9e-24 108 23 13 460 1 gedC Atrochrysone carboxylic acid synthase Aspergillus terreus (strain NIH 2624 / FGSC A1156)
S3D9F1 4.08e-24 108 24 11 438 1 gloL Highly reducing polyketide synthase gloL Glarea lozoyensis (strain ATCC 20868 / MF5171)
D4AU31 4.56e-24 108 26 6 376 3 swnK PKS-NRPS hybrid synthetase swnK Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
M2XHZ5 4.95e-24 108 27 12 388 2 pksA Norsolorinic acid synthase Dothistroma septosporum (strain NZE10 / CBS 128990)
Q30DW5 4.95e-24 108 27 12 388 2 pksA Norsolorinic acid synthase Dothistroma septosporum
G0R6S9 5.11e-24 108 25 8 379 2 sor2 Non-reducing polyketide synthase sor2 Hypocrea jecorina (strain QM6a)
A5PHD6 7.01e-24 108 23 9 438 1 aspks1 3-methylorcinaldehyde synthase Sarocladium schorii
A0A2Z5XAL7 7.03e-24 108 31 7 291 1 phm1 Hybrid PKS-NRPS synthetase phm1 Pyrenochaetopsis sp.
A2QTE9 7.58e-24 108 25 12 433 3 epaA Non-reducing polyketide synthase epaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
G0R6S8 7.7e-24 108 25 5 365 2 sor1 Highly reducing polyketide synthase sor1 Hypocrea jecorina (strain QM6a)
Q2HBN0 8.38e-24 108 27 9 376 1 cghG Hybrid PKS-NRPS synthetase cghG Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
B6F209 8.91e-24 107 24 7 379 1 cpaA Cyclo-acetoacetyl-L-tryptophan synthase Aspergillus oryzae
G3XMC4 9.7e-24 107 25 12 433 1 azaA Non-reducing polyketide synthase azaA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q4W944 1.04e-23 107 24 8 369 1 encA Atrochrysone carboxylic acid synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A1CLY8 1.22e-23 107 25 8 398 3 ccsA Polyketide synthase-nonribosomal peptide synthetase Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
E5A7D9 1.52e-23 107 24 7 404 2 pks5 Highly reducing polyketide synthase pks5 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
P9WET9 1.56e-23 107 24 9 375 1 PvBS090_009107 Non-reducing polyketide synthase PvBS090_009107 Byssochlamys spectabilis
A0A411PQP9 1.57e-23 107 24 15 456 3 Agnpks1 Atrochrysone carboxylic acid synthase Agnpks1 Paecilomyces divaricatus
A0A8F4S6Z6 1.75e-23 107 25 12 445 1 pydA Hybrid PKS-NRPS synthetase pydA Acremonium sp.
Q54KU3 1.79e-23 107 25 14 445 3 pks25 Probable polyketide synthase 25 Dictyostelium discoideum
A0A1W5T1T1 1.84e-23 107 24 10 399 2 poxF Highly reducing polyketide synthase poxF Penicillium oxalicum
P9WEZ4 2e-23 107 27 7 369 2 pytA Hybrid PKS-NRPS synthetase pytA Aspergillus terreus
S0DZM7 2.08e-23 106 22 10 445 1 bik1 Bikaverin polyketide synthase bik1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
S7Z800 2.17e-23 106 30 10 294 3 opdA Hybrid PKS-NRPs synthetase opdA Penicillium oxalicum (strain 114-2 / CGMCC 5302)
D9N1A1 2.32e-23 106 25 7 384 2 ACTTS3 Highly reducing polyketide synthase ACTTS3 Alternaria alternata
K2QVI8 2.7e-23 106 24 6 363 1 dpmpA Non-reducing polyketide synthase dpmpA Macrophomina phaseolina (strain MS6)
A0A084API3 3.13e-23 106 25 8 368 3 SAT13 Highly reducing polyketide synthase SAT13 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
Q4WLD4 3.29e-23 106 27 11 396 1 pyr2 Non-reducing polyketide synthase pyr2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q0CF73 3.34e-23 106 25 8 372 1 ATEG_07661 Non-reducing polyketide synthase ATEG_07661 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
E9F646 3.53e-23 106 24 8 379 1 Pks1 Polyketide synthase 1 Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
P40806 4.13e-23 105 24 7 415 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
P40806 1.68e-22 104 26 11 435 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
P40806 2.74e-21 100 24 11 451 1 pksJ Polyketide synthase PksJ Bacillus subtilis (strain 168)
E9F8M3 4.22e-23 105 26 9 381 1 swnK PKS-NRPS hybrid synthetase swnK Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
B8NYX0 4.33e-23 105 25 8 439 2 fluP Cluster 41 polyketide synthase Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
B8M9J9 5.07e-23 105 24 7 373 1 tropA 3-methylorcinaldehyde synthase tropA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
S7ZFK6 6.85e-23 105 25 8 393 2 poxE Hybrid PKS-NRPS synthetase poxE Penicillium oxalicum (strain 114-2 / CGMCC 5302)
P9WET5 6.97e-23 105 23 13 445 1 Preu4 Non-reducing polyketide synthase Preu4 Preussia isomera
P9WET1 7.75e-23 105 24 11 399 1 Preu7 Non-reducing polyketide synthase Preu7 Preussia isomera
B0G103 7.88e-23 105 22 10 452 3 pks10 Probable polyketide synthase 10 Dictyostelium discoideum
A0A284RE13 8.1e-23 105 25 14 441 1 armB Orsellinic acid synthase ArmB Armillaria ostoyae
A0A455LXK0 8.25e-23 105 25 6 325 2 ntnG Non-reducing polyketide synthase ntnG Nectria sp.
A0A075TRC0 8.38e-23 104 26 7 370 1 patK 6-methylsalicylic acid synthase Penicillium expansum
A0A0E4AZP0 8.44e-23 105 29 6 289 3 fsa1 Hybrid PKS-NRPS synthetase fsa1 Fusarium sp. (strain FN080326)
A0A411KUP8 8.91e-23 105 28 8 345 1 ucsA Hybrid PKS-NRPS synthetase ucsA Acremonium sp.
G3KLH6 9.12e-23 104 23 12 449 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger
A2QX22 9.28e-23 104 23 12 449 1 adaA Non-reducing polyketide synthase adaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A0A1W5T1U1 9.36e-23 104 25 8 393 2 poxE Hybrid PKS-NRPS synthetase poxE Penicillium oxalicum
Q9ZGI2 9.48e-23 104 23 8 376 1 pikAIV Narbonolide/10-deoxymethynolide synthase PikA4, module 6 Streptomyces venezuelae
A2QUI2 9.87e-23 104 25 9 376 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
G2Q9A5 1.02e-22 104 28 8 304 1 mycA Hybrid PKS-NRPS synthetase mycA Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)
B8MV60 1.03e-22 104 24 12 444 3 tpeB Non-reducing polyketide synthase tpeB Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q0D159 1.05e-22 104 26 10 398 2 ATEG_00325 Hybrid PKS-NRPS synthetase ATEG_00325 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q5BEJ6 1.09e-22 104 23 6 367 1 afoE Iterative polyketide synthase afoE Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A2I2F2N6 1.19e-22 104 28 7 284 1 cfoA Chalcone synthase cfoA Aspergillus candidus
I1S166 1.23e-22 104 25 9 453 2 FSL1 Fusarielin synthase FSL1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A0A0B4ESU9 1.31e-22 104 24 8 379 1 Pks1 Polyketide synthase 1 Metarhizium brunneum (strain ARSEF 3297)
A0A167LUQ4 1.36e-22 104 25 8 397 3 fumoS Fumosorinone synthetase Cordyceps fumosorosea (strain ARSEF 2679)
A0A0B4FTU6 1.45e-22 104 24 8 379 1 Pks1 Polyketide synthase 1 Metarhizium anisopliae (strain ARSEF 549)
G3XLL5 1.47e-22 104 25 9 376 3 albA Non-reducing polyketide synthase albA Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q8J0F7 1.49e-22 104 25 10 398 1 mlcA Compactin nonaketide synthase, polyketide synthase component Penicillium citrinum
S0EEY3 1.51e-22 104 24 12 437 1 FUS1 Fusarin C synthetase Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
P9WQE1 1.53e-22 103 29 8 288 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQE0 1.53e-22 103 29 8 288 3 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
S4W172 1.63e-22 104 29 6 289 1 eqxS Equisetin synthetase eqxS Fusarium heterosporum
A0A8F4S8Q3 1.63e-22 104 26 13 404 1 gkaA Hybrid PKS-NRPS synthetase gkaA Penicillium citrinum
W7MLD7 1.64e-22 104 24 11 437 1 FUS1 Fusarin C synthetase Gibberella moniliformis (strain M3125 / FGSC 7600)
Q7TXL6 1.67e-22 103 29 8 288 1 ppsE Phenolphthiocerol/phthiocerol polyketide synthase subunit E Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
W7MT31 1.69e-22 103 25 6 366 1 FUB1 Reducing polyketide synthase FUB1 Gibberella moniliformis (strain M3125 / FGSC 7600)
A0A0B4G9F9 1.96e-22 103 24 8 379 1 Pks1 Polyketide synthase 1 Metarhizium guizhouense (strain ARSEF 977)
B2HIL7 2.12e-22 103 28 7 288 1 pks15/1 Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 Mycobacterium marinum (strain ATCC BAA-535 / M)
A0A4P8DJU2 2.13e-22 103 24 15 460 3 dmx-nrPKS Atrochrysone carboxylic acid synthase Cryptosporiopsis sp. (strain 8999)
Q2HEW5 2.45e-22 103 31 10 296 2 cheA PKS-NRPS hybrid synthetase cheA Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
P40872 2.5e-22 103 27 17 455 1 pksM Polyketide synthase PksM Bacillus subtilis (strain 168)
P40872 3.11e-21 100 23 8 386 1 pksM Polyketide synthase PksM Bacillus subtilis (strain 168)
P40872 8.55e-21 99 24 13 448 1 pksM Polyketide synthase PksM Bacillus subtilis (strain 168)
A0A0N7D4P6 2.65e-22 103 26 7 365 2 Dhc3 Highly reducing polyketide synthase Dhc3 Alternaria cinerariae
A0A7R7ZK98 2.66e-22 103 24 13 414 3 AcPKS Atrochrysone carboxylic acid synthase Aspergillus chevalieri
A0A2L0P0K3 2.7e-22 103 27 10 381 1 TwmB Polyketide synthase-nonribosomal peptide synthetase TwmB Talaromyces wortmannii
A0A1L9UCG2 2.83e-22 103 26 7 320 3 albA Non-reducing polyketide synthase albA Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)
P0CU84 2.91e-22 103 26 13 439 1 apmlA Highly reducing polyketide synthase apmlA Arthrinium phaeospermum
A0JJU1 3.03e-22 103 25 9 396 1 tenS Tenellin synthetase Beauveria bassiana
J4KMC1 3.14e-22 103 25 9 397 1 tenS Tenellin synthetase Beauveria bassiana (strain ARSEF 2860)
Q3S2T9 3.37e-22 103 24 12 455 1 mokA Lovastatin nonaketide synthase mokA Monascus pilosus
A0A2H3CTK0 3.54e-22 103 25 14 441 1 armB Orsellinic acid synthase armB Armillaria gallica
B8N8R0 3.89e-22 102 24 9 374 2 afvB Non-reducing polyketide synthase afvB Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0A0D2YG10 3.89e-22 102 25 6 366 1 FUB1 Reducing polyketide synthase FUB1 Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936)
A0A0B4H4F0 3.97e-22 102 24 8 379 1 Pks1 Polyketide synthase 1 Metarhizium majus (strain ARSEF 297)
A0A4P8GHJ1 4.09e-22 102 25 10 384 1 eupA 3-methylorcinaldehyde synthase Phoma sp.
C5H885 4.11e-22 102 27 10 371 3 rads1 Reducing polyketide synthase rads1 Floropilus chiversii
E9EHG2 4.35e-22 102 25 10 391 2 Pks2 Polyketide synthase 2 Metarhizium acridum (strain CQMa 102)
Q5BH30 4.78e-22 102 23 14 451 3 mdpG Atrochrysone carboxylic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A1V6NYI6 4.89e-22 102 27 10 383 3 verA Highly reducing polyketide synthase verA Penicillium polonicum
Q55DM7 4.98e-22 102 24 12 437 3 pks2 Probable polyketide synthase 2 Dictyostelium discoideum
A0A6F9DXA0 5.36e-22 102 23 14 448 1 men1 Partially reducing polyketide synthase men1 Menisporopsis theobromae
P49327 5.54e-22 102 24 13 426 1 FASN Fatty acid synthase Homo sapiens
A0A2I2F262 5.64e-22 102 26 7 372 1 acdB PKS-NRPS hybrid synthetase acdB Aspergillus candidus
A0A2U8NEV6 5.72e-22 102 24 8 379 1 Pks1 Polyketide synthase 1 Metarhizium acridum (strain CQMa 102)
Q5B0D0 6e-22 102 24 14 452 1 aptA Non-reducing polyketide synthase aptA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P9WEX0 6.21e-22 102 26 11 421 1 dpasA Non-reducing polyketide synthase dpasA Apiospora sacchari
A0A142C799 6.51e-22 102 26 8 339 1 phnA Non-reducing polyketide synthase phnA Penicillium herquei
I3ZNU9 8.74e-22 102 25 14 441 1 armB Orsellinic acid synthase armB Armillaria mellea
A0A6H0YV38 9.76e-22 101 24 12 439 2 crz7 Non-reducing polyketide synthase crz7 Cladonia metacorallifera
Q4WAZ9 9.8e-22 101 26 9 365 2 NRPS14 PKS-NRPS hybrid synthetase psoA Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0A0C6E0I7 1.02e-21 101 25 9 384 1 bet1 Highly reducing polyketide synthase bet1 Neocamarosporium betae
A0A1B4XBH3 1.13e-21 101 28 5 283 3 sdnO Highly reducing polyketide synthase sdnO Sordaria araneosa
Q54TW0 1.25e-21 101 23 11 453 2 pks18 Probable polyketide synthase 18 Dictyostelium discoideum
Q5B8A0 1.3e-21 101 24 8 378 1 pkfA Non-reducing polyketide synthase pkfA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A4P8DJV2 1.35e-21 101 24 8 389 3 dmxL2 Highly reducing polyketide synthase dmxL2 Cryptosporiopsis sp. (strain 8999)
B6QK81 1.38e-21 101 25 13 440 3 pks12 Non-reducing polyketide synthase pks12 Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)
D7RJN6 1.38e-21 101 25 13 440 3 pks12 Non-reducing polyketide synthase pks12 Talaromyces marneffei
Q54IX3 1.45e-21 101 25 10 348 3 pks26 Probable polyketide synthase 26 Dictyostelium discoideum
A0A1L9WQM9 1.61e-21 101 23 8 440 2 acrA Highly reducing polyketide synthase acrA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A1P8NTI3 2.05e-21 100 24 11 400 2 pks8 Non-reducing polyketide synthase 8 Pestalotiopsis microspora
M2YKT6 2.15e-21 100 27 10 379 2 hps1 Hybrid PKS-NRPS synthetase 1 Dothistroma septosporum (strain NZE10 / CBS 128990)
B8MKY6 2.55e-21 100 28 6 281 1 tstA Highly reducing polyketide synthase tstA Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
Q0C8M3 2.93e-21 100 24 9 397 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus (strain NIH 2624 / FGSC A1156)
N4WHE3 3.35e-21 100 25 12 400 3 PKS1 Reducing polyketide synthase PKS1 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
I1RLA7 3.51e-21 100 25 9 394 2 FGR1 Highly reducing polyketide synthase 2 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q9Y8A5 3.55e-21 100 24 9 397 1 lovB Lovastatin nonaketide synthase, polyketide synthase component Aspergillus terreus
A5ABG0 3.57e-21 100 25 9 432 1 pynA Hybrid PKS-NRPS synthetase pynA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
B8NJG3 4.1e-21 100 25 11 396 3 lepA Hybrid PKS-NRPS synthetase lepA Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167)
A0A348HAX6 4.22e-21 99 26 10 384 1 phiA Highly reducing polyketide synthase phiA Fungal sp. (strain ATCC 74256)
A0A455M7S4 4.28e-21 99 25 9 375 1 atnG Non-reducing polyketide synthase atnG Arthrinium sp.
P9WEX6 4.63e-21 99 26 10 370 1 dpmaA Non-reducing polyketide synthase dpmaA Metarhizium anisopliae
Q50LG3 4.88e-21 99 27 6 279 3 AFT9-1 Highly reducing polyketide synthase AFT9-1 Alternaria alternata
Q9Y7D5 5.28e-21 99 23 5 367 1 lovF Lovastatin diketide synthase lovF Aspergillus terreus
Q5AZ32 5.33e-21 99 26 13 364 1 pkbA Non-reducing polyketide synthase pkbA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
E9F5E7 5.56e-21 99 25 9 370 1 subA Non-reducing polyketide synthase subA Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075)
Q4WKW9 5.89e-21 99 25 7 366 1 fgnA Fumigermin synthase Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WZA8 6.13e-21 99 24 9 377 1 alb1 Conidial pigment polyketide synthase alb1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
V5Y0F7 6.39e-21 99 26 10 405 3 AFT16-1 Reducing polyketide synthase AFT16-1 Alternaria alternata
P9WES9 7.54e-21 99 24 13 441 1 PFUR17_0229 Non-reducing polyketide synthase PFUR17_0229 Pseudevernia furfuracea
W3X8X8 8.18e-21 99 26 7 288 1 fnsA Naringenin synthase Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
A0A3T0ZHJ0 8.33e-21 99 24 8 421 1 cle1 Triacetic acid lactone synthase cle1 Aspergillus versicolor
P0DUT7 9.01e-21 99 25 14 430 1 Ba17a Highly reducing polyketide synthase 17 Metarhizium anisopliae
I1RF58 1.15e-20 98 25 7 323 1 PKS12 Non-reducing polyketide synthase PKS12 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
A7UMW1 1.37e-20 98 24 11 379 2 PKS1 Non-reducing polyketide synthase 1 Elsinoe fawcettii
Q558Y6 1.42e-20 98 23 10 450 3 pks14 Probable polyketide synthase 14 Dictyostelium discoideum
S0DRI1 1.44e-20 98 25 6 366 1 FUB1 Reducing polyketide synthase FUB1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
S0EET5 1.49e-20 98 26 11 402 2 PKS19 Polyketide synthase 19 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q5BBP5 1.58e-20 98 23 10 422 1 pkhB Highly reducing polyketide synthase pkhB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A443HK81 1.58e-20 98 22 11 448 1 VdtA Non-reducing polyketide synthase VdtA Byssochlamys spectabilis
A0A8F4SKJ7 1.62e-20 98 23 11 435 1 atr1 Non-reducing polyketide synthase atr1 Stereocaulon alpinum
Q12053 1.62e-20 98 25 9 376 1 aflC Norsolorinic acid synthase Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)
B0G101 1.71e-20 97 23 9 442 3 pks8 Probable polyketide synthase 8/35 Dictyostelium discoideum
G3JUI8 1.77e-20 97 25 12 384 1 milA Highly reducing polyketide synthase milA Cordyceps militaris (strain CM01)
Q71SP7 1.91e-20 97 24 13 425 1 FASN Fatty acid synthase Bos taurus
A0A3G9GQ29 1.98e-20 97 25 11 397 1 cdmE 6-hydroxymellein synthase cdmE Talaromyces verruculosus
A0A8D5M692 2.22e-20 97 25 12 425 1 esdpA Non-reducing polyketide synthase esdpA Penicillium shearii
B0G100 2.22e-20 97 24 9 441 3 pks7 Probable polyketide synthase 7 Dictyostelium discoideum
F9XMW3 2.26e-20 97 23 12 411 3 PKS1 Non-reducing polyketide synthase PKS1 Zymoseptoria tritici (strain CBS 115943 / IPO323)
G1XU04 2.54e-20 97 25 7 369 1 AOL_s00215g283 6-methylsalicylic acid synthase AOL_s00215g283 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491)
A0A1L9WN37 2.73e-20 97 25 6 367 1 acuA 6-methylsalicylic acid synthase acuA Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
Q12397 2.79e-20 97 25 11 385 2 stcA Norsolorinic acid synthase stcA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
S0DS59 3.03e-20 97 27 5 290 2 PKS-NRPS1 Trichosetin synthetase PKS-NRPS1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q559A9 3.06e-20 97 23 12 445 3 pks13 Probable polyketide synthase 13 Dictyostelium discoideum
B6H999 3.43e-20 97 28 8 290 1 xilA Highly reducing polyketide synthase xilA Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255)
K2QYX5 4.79e-20 96 26 12 399 1 mpsA Hybrid PKS-NRPS synthetase mpsA Macrophomina phaseolina (strain MS6)
P12785 5.23e-20 96 24 12 425 1 Fasn Fatty acid synthase Rattus norvegicus
Q03149 5.26e-20 96 25 7 320 1 wA Conidial yellow pigment biosynthesis polyketide synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A6S5ZY48 5.37e-20 96 25 10 363 2 g433 Highly reducing polyketide synthase g433 Fusarium sp.
A0A2I1C3X5 5.78e-20 96 25 10 364 1 nsrB Atrochrysone carboxylic acid synthase nsrB Aspergillus novofumigatus (strain IBT 16806)
P19096 8.08e-20 95 24 13 425 1 Fasn Fatty acid synthase Mus musculus
K3VA96 8.41e-20 95 22 7 378 3 PKS40 Highly reducing polyketide synthase 40 Fusarium pseudograminearum (strain CS3096)
A0A0G0AID6 9.13e-20 95 26 8 378 1 thnA Hybrid PKS-NRPS synthetase thnA Trichoderma harzianum
Q54KU5 1.04e-19 95 24 14 452 3 pks24 Probable polyketide synthase 24 Dictyostelium discoideum
P9WET8 1.1e-19 95 24 8 377 2 Preu1 Highly reducing polyketide synthase Preu1 Preussia isomera
L7X8J4 1.23e-19 95 25 8 365 1 curS1 Highly reducing polyketide synthase curS1 Aspergillus terreus
Q54B51 1.38e-19 95 23 13 441 3 pks44 Probable polyketide synthase 44 Dictyostelium discoideum
A0A4P8WAE5 1.46e-19 95 25 10 396 3 pyiS Polyketide synthase-nonribosomal peptide synthetase pyiS Pyricularia grisea
A0A0N9HNS9 1.68e-19 94 22 13 441 3 desS Desertorin synthase Aspergillus desertorum
A0A6F8RNP4 1.68e-19 95 26 14 408 1 grgA Reducing polyketide synthase grgA Penicillium sp.
A0A179H0J7 1.7e-19 95 26 11 384 2 lcsC Highly reducing polyketide synthase lcsC Purpureocillium lilacinum
Q5BBP8 1.72e-19 94 24 9 382 1 pkhA Non-reducing polyketide synthase pkhA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
G3XNF4 1.83e-19 94 25 10 431 1 ATPKS PKS-NRPS hybrid synthetase ATPKS Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
Q86AE3 2.01e-19 94 23 9 445 2 pks9 Probable polyketide synthase 9/36 Dictyostelium discoideum
B3FWT3 2.04e-19 94 26 9 370 1 hpm8 Reducing polyketide synthase hmp8 Hypomyces subiculosus
Q0CZH1 2.35e-19 94 26 7 340 2 pytA Hybrid PKS-NRPS synthetase pytA (Fragment) Aspergillus terreus (strain NIH 2624 / FGSC A1156)
R4WH05 2.51e-19 94 24 7 384 3 ACRTS2 Highly reducing polyketide synthase ACRTS2 Alternaria alternata
A0A9P5GG56 3.09e-19 94 28 8 290 1 xilA Highly reducing polyketide synthase xilA Penicillium crustosum
P9WEQ0 3.17e-19 94 26 9 377 3 olcA Non-reducing polyketide synthase olcA Penicillium canescens
P36189 3.27e-19 91 25 9 367 1 FASN Fatty acid synthase (Fragment) Anser anser anser
P22367 3.45e-19 94 26 7 370 1 None 6-methylsalicylic acid synthase Penicillium patulum
S0DTP6 3.7e-19 94 26 10 338 2 FSR1 Non-reducing polyketide synthase fsr1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
A0A089FSA4 3.72e-19 94 27 8 307 3 prlS Hybrid PKS-NRPS synthetase prlS Fungal sp. (strain NRRL 50135)
A0A1L9WLD9 4.03e-19 93 23 14 453 1 AacuL Atrochrysone carboxylic acid synthase AacuL Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)
A0A084B9Z6 4.47e-19 93 22 6 370 3 SAT8 Non-reducing polyketide synthase SAT8 Stachybotrys chartarum (strain CBS 109288 / IBT 7711)
Q0UI00 4.58e-19 93 24 10 382 1 elcA Non-reducing polyketide synthase elcA (Fragment) Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
G9N4B2 4.71e-19 93 23 7 373 1 virA Highly reducing polyketide synthase virA Hypocrea virens (strain Gv29-8 / FGSC 10586)
B0G170 5.48e-19 93 25 7 344 3 pks28 Probable polyketide synthase 28 Dictyostelium discoideum
D7UQ44 5.93e-19 93 25 10 376 1 sol1 Prosolanapyrone synthase Alternaria solani
Q6DQW3 6.1e-19 93 23 10 381 1 CTB1 Non-reducing polyketide synthase CTB1 Cercospora nicotianae
Q54B49 6.85e-19 93 23 11 434 3 pks45 Probable polyketide synthase 45 Dictyostelium discoideum
A0A2G5IC96 7.87e-19 92 23 10 381 3 CTB1 Non-reducing polyketide synthase CTB1 Cercospora beticola
Q0C9L7 8.82e-19 92 27 5 292 1 ctvA Highly reducing polyketide synthase ctvA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
P9WET3 9.07e-19 92 22 12 445 1 Preu8 Non-reducing polyketide synthase Preu8 Preussia isomera
B0G0Z9 9.78e-19 92 22 9 445 3 pks6 Probable polyketide synthase 6 Dictyostelium discoideum
A0A0M4L8I7 9.86e-19 92 27 14 386 1 aurA Highly reducing polyketide synthase aurA Calcarisporium arbuscula
E9KMQ2 1.12e-18 92 24 12 441 2 PKS16 Non-reducing polyketide synthase PKS16 Cladonia grayi
A0A2U8NET4 1.34e-18 92 23 9 390 1 Pks1 Polyketide synthase 1 Metarhizium album (strain ARSEF 1941)
Q3S2U6 1.47e-18 92 24 9 365 1 mokB Lovastatin diketide synthase mokB Monascus pilosus
A0A1B5L6A0 1.6e-18 92 22 9 387 1 UVI_02036160 Non-reducing polyketide synthase ustP Ustilaginoidea virens
Q2T4N2 1.72e-18 92 24 13 447 3 thaH Polyketide synthase ThaH Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2T4N2 4.12e-16 84 25 12 433 3 thaH Polyketide synthase ThaH Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A0A1U8QN18 1.83e-18 91 24 7 399 1 sdgA Highly reducing polyketide synthase sdgA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5AUX1 1.91e-18 91 23 12 447 1 orsA Orsellinic acid synthase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5W262 2.36e-18 90 27 8 275 1 pigJ Beta-ketoacyl synthase PigJ Serratia sp. (strain ATCC 39006)
Q54FQ2 2.78e-18 91 25 13 443 3 pks30 Probable polyketide synthase 30 Dictyostelium discoideum
Q54FN7 2.79e-18 91 25 12 448 3 pks33 Probable polyketide synthase 33 Dictyostelium discoideum
A0A2V5GX43 2.84e-18 91 24 7 337 3 pyvA Hybrid PKS-NRPS synthetase pyvA Aspergillus violaceofuscus (strain CBS 115571)
Q54ED7 2.88e-18 91 24 12 443 3 pks40 Probable polyketide synthase 40 Dictyostelium discoideum
A0A443HK66 3.76e-18 90 28 6 275 3 VdtX Highly reducing polyketide synthase VdtX Byssochlamys spectabilis
E5AE40 4.32e-18 90 25 14 445 2 PKS2 Highly reducing polyketide synthase PKS2 Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8)
P9WES1 4.61e-18 90 24 5 310 1 None Atrochrysone carboxylic acid synthase PKS1 Calonarius odorifer
A0A0S6XH49 4.78e-18 90 28 7 281 1 frbB Highly reducing polyketide synthase frbB Fungal sp. (strain No.11243)
A0A067MTM1 5.26e-18 90 22 11 431 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Botryobasidium botryosum (strain FD-172 SS1)
W7LKX1 5.88e-18 90 26 8 285 2 FUM1 Highly reducing polyketide synthase FUM1 Gibberella moniliformis (strain M3125 / FGSC 7600)
A0A1B3PEI8 6.51e-18 90 29 5 257 1 ORF-B Polyunsaturated fatty acid synthase subunit B Thraustochytrium sp. (strain ATCC 26185 / S-3)
Q0CF75 6.86e-18 90 26 8 291 1 ATEG_07659 Highly reducing polyketide synthase ATEG_07659 Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q54QD3 6.95e-18 90 23 12 436 3 pks22 Probable polyketide synthase 22 Dictyostelium discoideum
Q54FQ3 7.38e-18 90 24 11 448 3 pks29 Probable polyketide synthase 29 Dictyostelium discoideum
A0A481WR96 8.79e-18 89 25 11 370 3 claI Highly reducing polyketide synthase claI Penicillium crustosum
P9WES2 1.15e-17 89 24 5 312 1 None Atrochrysone carboxylic acid synthase PKS4 Calonarius odorifer
Q5BEJ4 1.2e-17 89 25 7 290 1 afoG Asperfuranone polyketide synthase afoG Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q7SHI6 1.22e-17 89 24 8 377 2 srdA Highly reducing polyketide synthase srdA Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
P0DUK1 1.23e-17 89 24 9 359 3 pspA Highly reducing polyketide synthase pspA Penicillium soppii
Q55CN6 1.49e-17 89 23 13 418 3 pks3 Probable polyketide synthase 3 Dictyostelium discoideum
A0A0A2KT65 1.52e-17 89 24 8 326 2 melA Conidial yellow pigment biosynthesis polyketide synthase melA Penicillium expansum
A0A1V6PAF7 1.59e-17 89 30 8 290 1 calA Highly reducing polyketide synthase calA Penicillium decumbens
S0EMV0 1.65e-17 89 25 10 414 1 GPY1 Highly reducing polyketide synthase GPY1 Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831)
Q54FC8 1.89e-17 88 25 13 446 3 pks39 Probable polyketide synthase 39 Dictyostelium discoideum
A0A068ABB7 2.15e-17 88 25 8 377 1 Bref-PKS Highly reducing polyketide synthase Eupenicillium brefeldianum
Q54FD2 2.3e-17 88 25 13 446 3 pks38 Probable polyketide synthase 38 Dictyostelium discoideum
B4XYB8 2.43e-17 88 26 7 360 1 aziB 5-methyl-1-naphthoate synthase Streptomyces sahachiroi
Q4WAY3 3.41e-17 87 26 13 411 1 af370 Fumagillin dodecapentaenoate synthase af370 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P9WET2 4.69e-17 87 25 16 441 1 Preu6 Non-reducing polyketide synthase Preu6 Preussia isomera
A0A3G9H990 4.72e-17 87 26 7 279 1 ALT1 Highly reducing polyketide synthase ALT1 Alternaria alternata
Q54FQ1 4.81e-17 87 24 11 446 3 pks31 Probable polyketide synthase 31 Dictyostelium discoideum
P9WET4 4.83e-17 87 26 10 406 1 Preu5 Highly reducing polyketide synthase Preu5 Preussia isomera
Q8J0F5 4.88e-17 87 26 6 293 1 mlcB Compactin diketide synthase mlcB Penicillium citrinum
Q54ED6 5.94e-17 87 23 10 401 3 pks41 Probable polyketide synthase 41 Dictyostelium discoideum
N4WHA7 6.82e-17 87 25 8 284 3 PKS2 Reducing polyketide synthase PKS2 Cochliobolus heterostrophus (strain C4 / ATCC 48331 / race T)
Q54G30 7.09e-17 87 25 8 347 3 pks27 Probable polyketide synthase 27 Dictyostelium discoideum
O31784 7.57e-17 86 23 12 449 1 pksR Polyketide synthase PksR Bacillus subtilis (strain 168)
O31784 8.14e-17 86 23 14 453 1 pksR Polyketide synthase PksR Bacillus subtilis (strain 168)
Q5AXA9 8.28e-17 86 22 11 435 1 pkgA Non-reducing polyketide synthase pkgA Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54FN2 9.69e-17 86 24 11 445 3 pks34 Probable polyketide synthase 34 Dictyostelium discoideum
Q0UK48 1.03e-16 86 25 8 371 1 sthA Highly reducing polyketide synthase sthA Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A2R6H1 1.26e-16 86 24 7 367 2 otaA Highly reducing polyketide synthase otaA Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
A2QK66 1.29e-16 85 23 10 380 3 ktnS Kotanin synthase Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q54QD1 1.38e-16 85 22 13 438 3 pks23 Probable polyketide synthase 23 Dictyostelium discoideum
Q86ZD9 1.62e-16 85 23 8 367 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain C2932)
B3FWT6 1.68e-16 85 22 11 449 1 rdc1 Non-reducing polyketide synthase rdc1 Metacordyceps chlamydosporia
A0A0A2JW91 2.31e-16 85 25 11 380 1 cnsI Highly reducing polyketide synthase cnsI Penicillium expansum
A0A0D1DNX1 2.37e-16 85 25 9 354 2 fas2 Fatty acid synthase 2 Ustilago maydis (strain 521 / FGSC 9021)
P9WEV0 3.07e-16 85 25 8 368 3 valA Highly reducing polyketide synthase valA Aspergillus terreus
B3FWS8 3.6e-16 84 21 11 442 1 hpm3 Non-reducing polyketide synthase hmp3 Hypomyces subiculosus
A0A384XH94 4.38e-16 84 25 5 370 1 stpks1 Highly reducing polyketide synthase stpks1 Strobilurus tenacellus
I1RL11 5.11e-16 84 26 8 284 1 dpfgA Non-reducing polyketide synthase dpfgA Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
S7RK07 7.95e-16 83 26 13 376 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Gloeophyllum trabeum (strain ATCC 11539 / FP-39264 / Madison 617)
A0A1R3RGK0 8.09e-16 83 24 8 367 1 otaA Highly reducing polyketide synthase otaA Aspergillus carbonarius (strain ITEM 5010)
Q0V6Q6 9.25e-16 83 30 9 266 1 phmA Polyketide synthase-nonribosomal peptide synthetase phmA Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
A0A3G1DJF3 1.03e-15 83 27 6 283 2 pks2 Squalestatin hexaketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
Q54FP8 1.45e-15 82 24 11 449 3 pks32 Probable polyketide synthase 32 Dictyostelium discoideum
Q558W4 1.92e-15 82 25 9 308 3 pks15 Probable polyketide synthase 15 Dictyostelium discoideum
A0A1W7M1U5 2.51e-15 82 24 9 325 1 pgmA Non-reducing polyketide synthase pgmA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
G3J9P0 4.03e-15 81 23 14 453 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Cordyceps militaris (strain CM01)
A0A455LLX1 4.82e-15 81 25 6 283 1 atnH Highly reducing polyketide synthase atnH Arthrinium sp.
A0A1B7YCC9 5.25e-15 81 22 8 421 1 dpchA Non-reducing polyketide synthase dpchA Colletotrichum higginsianum (strain IMI 349063)
G4N296 7.24e-15 80 22 7 379 2 PKS19 Highly reducing polyketide synthase 19 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q9HU15 7.6e-15 80 28 10 271 1 fabY Beta-ketoacyl-[acyl-carrier-protein] synthase FabY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
C5H882 8.09e-15 80 23 12 449 3 radS2 Non-reducing polyketide synthase rads2 Floropilus chiversii
A0A345BJN0 8.35e-15 80 27 6 277 1 clz14 Squalestatin hexaketide synthase clz14 Cochliobolus lunatus
A0A017SEX7 1.12e-14 80 25 3 278 1 fogA Highly reducing polyketide synthase fogA Aspergillus ruber (strain CBS 135680)
I1RVD8 1.3e-14 79 24 11 371 3 PKS6 Highly reducing polyketide synthase PKS6 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q0C8L6 2.51e-14 79 25 6 286 1 lovF Lovastatin diketide synthase lovF Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q0CS88 2.92e-14 79 27 6 238 2 tazB Highly reducing polyketide synthase tazB Aspergillus terreus (strain NIH 2624 / FGSC A1156)
W3X7U2 3.31e-14 78 22 7 322 2 PfmaE Conidial pigment polyketide synthase PfmaE Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
G3XMD1 4.91e-14 78 24 7 293 1 azaB Highly reducing polyketide synthase azaB Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
A0A0U4ZX08 8.45e-14 77 23 8 371 1 drtA Low-reducing polyketide synthase drtA Aspergillus calidoustus
A0A0N7D745 1.28e-13 76 23 4 315 2 Dhc5 Non-reducing polyketide synthase Dhc5 Alternaria cinerariae
Q5BA83 1.37e-13 76 22 7 367 3 easB Highly reducing polyketide synthase easB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
G0LET7 3.31e-13 75 23 13 441 2 BOA9 Reducing polyketide synthase BOA9 Botryotinia fuckeliana (strain B05.10)
A0A3G9K3K9 3.63e-13 75 22 13 437 1 hisps Hispidin synthase Neonothopanus nambi
A0A179H2I8 4.17e-13 75 30 7 208 2 lcsB Highly reducing polyketide synthase lcsB Purpureocillium lilacinum
L7XAV2 4.61e-13 75 22 7 378 1 curS2 Non-reducing polyketide synthase curS2 Aspergillus terreus
A0A0F7GFS4 5.39e-13 75 24 12 408 1 tasS Hybrid PKS-NRPS synthetase tasS Hapsidospora irregularis
G3J453 5.79e-13 74 26 8 276 1 cm3B Highly reducing polyketide synthase cm3B Cordyceps militaris (strain CM01)
A0A3G1DJH7 2.17e-12 72 22 8 367 1 pks1 Squalestatin tetraketide synthase Phoma sp. (strain ATCC 20986 / MF5453)
G4NEB1 2.19e-12 72 29 6 206 1 NEC1 Highly reducing polyketide synthase NEC1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A0A455M2Y3 2.21e-12 72 24 6 282 2 ntnH Highly reducing polyketide synthase ntnH Nectria sp.
W6QDA2 2.74e-12 72 28 4 206 1 anuA Highly reducing polyketide synthase anuA Penicillium roqueforti (strain FM164)
Q00681 3e-12 72 25 10 339 2 stcJ Fatty acid synthase alpha subunit stcJ Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q54D44 5.96e-12 71 21 7 377 3 pks42 Probable polyketide synthase 42 Dictyostelium discoideum
P9WET0 8.06e-12 71 29 6 206 1 Preu9 Polyketide synthase-like protein Preu9 Preussia isomera
D2E9X0 9.82e-12 70 24 12 382 2 DEP5 Reducing polyketide synthase DEP5 Alternaria brassicicola
Q2T4P1 2.29e-11 69 22 13 446 3 thaQ Polyketide synthase ThaQ Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A0A0N0DCA3 3.2e-11 69 24 11 384 2 DEP5 Reducing polyketide synthase DEP5 Fusarium langsethiae
G4N137 6.13e-11 68 27 6 246 1 TAS1 Hybrid PKS-NRPS synthetase TAS1 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
A0A125R003 8.8e-11 67 21 10 442 1 cla3 Non-reducing polyketide synthase cla3 Cladosporium cladosporioides
Q0CSA2 5.12e-10 65 25 8 248 1 tazA Non-reducing polyketide synthase tazA Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A0A098D6U0 6.38e-10 65 21 9 388 1 ZEA1 Non-reducing polyketide synthase ZEA1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
P9WET7 1.36e-09 64 27 6 219 2 Preu2 Reducing polyketide synthase Preu2 Preussia isomera
A0A345BJP0 6.24e-09 62 22 10 370 3 clz2 Squalestatin tetraketide synthase clz2 Cochliobolus lunatus
Q765N2 8.26e-08 58 33 2 123 3 FAS2 Fatty acid synthase subunit alpha Lachancea kluyveri
Q2TXF0 1.11e-07 58 33 2 133 3 oryfasA Fatty acid synthase subunit alpha Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P19097 1.17e-07 58 33 2 130 1 FAS2 Fatty acid synthase subunit alpha Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5B7V0 1.53e-07 57 31 2 118 1 pkiB Fatty acid synthase alpha subunit pkiB Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
A0A084R1H6 3.18e-07 56 22 9 376 3 ATR6 Highly reducing polyketide synthase ATR6 Stachybotrys chlorohalonata (strain IBT 40285)
M2YJJ3 5.76e-07 55 23 8 310 2 hexA Fatty acid synthase alpha subunit hexA Dothistroma septosporum (strain NZE10 / CBS 128990)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_15800
Feature type CDS
Gene fabF
Product beta-ketoacyl-ACP synthase II
Location 46296 - 47540 (strand: 1)
Length 1245 (nucleotides) / 414 (amino acids)

Contig

Accession ZDB_374
Length 116739 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_98
Orthogroup size 12
N. genomes 7

Actions

Genomic region

Domains

PF00109 Beta-ketoacyl synthase, N-terminal domain
PF02801 Beta-ketoacyl synthase, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0304 Lipid transport and metabolism (I)
Secondary metabolites biosynthesis, transport and catabolism (Q)
IQ 3-oxoacyl-(acyl-carrier-protein) synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MSERRVVVTGLGMLSPVGNTVDSSWKAVCAGQSGISLIDHFDTSNHATKFAGMVKDFNHEDFNISRKDARKMDLFIQYGIAAGIRAIEDSGIEVTEANATRIGAAIGSGIGGLGLIEENCSSLAAGGPRKVSPFFVPSTIINMVAGHLSIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGTEKASTPLGVAGFGAARALSTNNDNPQGASRPWDKDRDGFVLGDGAGMLVLEEYEHAKNRGAKIYAELVGFGMSSDAYHMTSPPENGDGAALAMANAIQDAGIPADSIGYINAHGTSTSAGDVAEAKAVETVFGEGTNVLVSSTKSMTGHLLGAAGAVESIFTILALRDQIVPPTINLDNQDEAVCKLDFVPGKARKVEGMEYALCNSFGFGGTNGSLIFRKI

Flanking regions ( +/- flanking 50bp)

GCGGTCACCCGACCGCCTTGTTTCTTTTATTTTCCCCCCGGAGGATAAGCGTGTCTGAGCGTCGTGTAGTCGTGACCGGACTTGGCATGTTATCTCCTGTCGGTAATACAGTCGATTCATCCTGGAAAGCTGTGTGTGCCGGGCAGAGTGGTATCAGCCTGATTGATCATTTTGACACCTCTAACCATGCGACCAAATTCGCAGGTATGGTAAAAGATTTCAATCACGAAGATTTTAATATTTCGCGCAAAGATGCCCGGAAGATGGATCTCTTCATTCAATACGGTATTGCAGCCGGTATCCGGGCAATTGAGGATTCCGGAATCGAAGTAACAGAAGCCAATGCAACCCGTATCGGAGCTGCGATTGGTTCTGGTATTGGTGGTCTCGGACTGATTGAAGAAAACTGCAGCTCTTTGGCTGCCGGCGGCCCGCGTAAAGTGAGCCCGTTCTTTGTTCCCTCAACTATCATCAATATGGTTGCCGGACACTTAAGTATTATGTACGGCCTGCGCGGACCAAGCATTTCCATTGCCACTGCCTGTACATCCGGCGTGCATAACATTGGTCATGCGGCCCGGATCATCGCTTACGGTGATGCGGATGTGATGGTTGCCGGTGGTACTGAAAAAGCCAGCACACCATTAGGTGTTGCCGGGTTCGGTGCTGCGCGTGCCTTATCCACCAATAATGACAATCCTCAGGGCGCAAGCCGTCCGTGGGATAAAGATCGTGACGGGTTTGTGCTCGGTGACGGTGCCGGTATGCTGGTGCTGGAAGAGTACGAACACGCGAAAAACCGCGGTGCGAAAATCTATGCGGAACTGGTCGGTTTCGGGATGAGCAGCGATGCTTATCACATGACATCACCACCGGAAAACGGTGACGGTGCCGCACTGGCCATGGCAAATGCGATTCAGGATGCAGGCATTCCTGCTGACAGCATCGGCTATATCAATGCGCACGGCACATCCACCTCTGCGGGTGATGTGGCGGAAGCGAAAGCCGTTGAAACGGTATTTGGTGAAGGAACCAACGTTCTGGTCAGTTCCACCAAATCCATGACTGGTCACCTGCTGGGTGCGGCCGGTGCAGTGGAATCCATTTTCACCATTCTGGCACTGCGTGATCAGATTGTACCGCCGACCATCAACCTGGATAATCAGGATGAAGCGGTCTGCAAACTCGACTTTGTACCGGGTAAAGCCCGCAAAGTGGAAGGTATGGAATACGCACTCTGTAACTCTTTCGGCTTCGGCGGAACCAACGGTTCCCTGATTTTCCGTAAGATCTGAGTCTGTTTTCTGAGAGAAAAGCGCCTGACGGCGCTTTTTTTTTACCTGGC