Homologs in group_2848

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10600 FBDBKF_10600 100.0 Morganella morganii S1 atoA Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit
EHELCC_14935 EHELCC_14935 100.0 Morganella morganii S2 atoA Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit
NLDBIP_14765 NLDBIP_14765 100.0 Morganella morganii S4 atoA Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit
HKOGLL_13200 HKOGLL_13200 100.0 Morganella morganii S5 atoA Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit
F4V73_RS14310 F4V73_RS14310 90.5 Morganella psychrotolerans - 3-oxoacid CoA-transferase subunit B

Distribution of the homologs in the orthogroup group_2848

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2848

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76459 9.88e-116 332 79 0 206 1 atoA Acetate CoA-transferase subunit beta Escherichia coli (strain K12)
P44874 1.46e-107 311 69 1 220 3 atoA Acetate CoA-transferase subunit beta Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23673 5.91e-79 239 55 2 213 1 ctfB Acetoacetyl-CoA:acetate/butyrate CoA-transferase beta subunit Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P42316 1.93e-75 229 51 1 210 1 scoB Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B Bacillus subtilis (strain 168)
P0C7I8 2.21e-72 221 52 1 206 3 lpsJ Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RVK3 2.78e-72 221 52 1 206 3 lpsJ Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B Xanthomonas campestris pv. campestris (strain B100)
P9WPW3 3.19e-71 219 54 1 200 1 scoB Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPW2 3.19e-71 219 54 1 200 3 scoB Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63651 3.19e-71 219 54 1 200 3 scoB Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P56007 3.46e-70 216 51 2 205 1 scoB Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZLE4 1.09e-69 214 51 2 205 3 scoB Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B Helicobacter pylori (strain J99 / ATCC 700824)
Q9W058 9.26e-67 216 51 3 214 1 Scot Succinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial Drosophila melanogaster
Q54JD9 4.37e-66 214 50 1 206 3 oxct1 Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial Dictyostelium discoideum
Q29551 1.03e-60 201 46 3 220 1 OXCT1 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Sus scrofa
P55809 4.55e-60 199 46 3 219 1 OXCT1 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Homo sapiens
B2GV06 6.05e-59 196 45 3 220 1 Oxct1 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Rattus norvegicus
Q9BYC2 1.59e-58 195 45 3 219 1 OXCT2 Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial Homo sapiens
Q9D0K2 1.92e-58 195 44 3 220 1 Oxct1 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial Mus musculus
O34466 2.68e-57 183 43 2 207 3 yodR Probable coenzyme A transferase subunit beta Bacillus subtilis (strain 168)
Q9ESL0 3.8e-57 192 45 3 215 2 Oxct2b Succinyl-CoA:3-ketoacid coenzyme A transferase 2B, mitochondrial Mus musculus
Q9JJN4 4.13e-57 191 45 3 215 2 Oxct2a Succinyl-CoA:3-ketoacid coenzyme A transferase 2A, mitochondrial Mus musculus
Q09450 1.21e-55 187 46 4 217 3 C05C10.3 Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial Caenorhabditis elegans
Q5XIJ9 2.22e-55 187 43 3 219 1 Oxct2a Succinyl-CoA:3-ketoacid coenzyme A transferase 2A, mitochondrial Rattus norvegicus
P0A102 1.04e-49 164 42 3 199 1 pcaJ 3-oxoadipate CoA-transferase subunit B Pseudomonas putida
P0A101 1.04e-49 164 42 3 199 3 pcaJ 3-oxoadipate CoA-transferase subunit B Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q59091 1.31e-43 148 39 2 205 1 pcaJ 3-oxoadipate CoA-transferase subunit B Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
F1CYZ5 2.21e-16 80 31 10 220 1 carA Caffeate CoA-transferase Acetobacterium woodii
P37766 1.69e-08 57 25 9 238 3 ydiF Acetate CoA-transferase YdiF Escherichia coli (strain K12)
Q8X5X6 2.02e-08 57 25 9 238 1 ydiF Acetate CoA-transferase YdiF Escherichia coli O157:H7
Q8VPF2 1.23e-06 51 27 5 155 1 catJ 3-oxoadipate CoA-transferase subunit B Pseudomonas knackmussii (strain DSM 6978 / CCUG 54928 / LMG 23759 / B13)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_14580
Feature type CDS
Gene atoA
Product Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit
Location 59629 - 60294 (strand: -1)
Length 666 (nucleotides) / 221 (amino acids)

Contig

Accession ZDB_372
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2848
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01144 Coenzyme A transferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2057 Lipid transport and metabolism (I) I Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01035 acetate CoA/acetoacetate CoA-transferase beta subunit [EC:2.8.3.8 2.8.3.9] Lysine degradation
Aminobenzoate degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system		 -

Protein Sequence

MNAKELIARRVALELNDGDVVNLGIGLPTQVANYLPEGVHITLQSENGFLGLGPVTTPDKNLVNAGGQPCGILPGASMFDSAFSFALIRGGHVDASVLGGLQVDEQANLANWVVPGKMVPGMGGAMDLVTGARKVIIAMEHCAKDGSAKILPECTMPLTAVKAVDVLVTELALFRFENDQMILCEYAPGTDIDTIREKTAAHFIVSPAICEMPLVTAGEAV

Flanking regions ( +/- flanking 50bp)

CACACCAGGGGCAATTATTGACTGGCTGATTGCAGAATAAGGAAAACATCATGAATGCAAAAGAATTAATCGCCCGCCGTGTGGCACTTGAACTGAATGACGGTGATGTGGTGAACCTCGGGATCGGGCTGCCGACACAGGTGGCGAACTATCTGCCGGAAGGCGTGCATATCACATTACAGTCAGAAAACGGCTTTCTCGGCCTCGGGCCGGTAACCACGCCGGATAAGAATCTGGTCAATGCGGGCGGGCAGCCGTGCGGCATCCTGCCGGGTGCGTCCATGTTTGACAGCGCCTTCTCTTTTGCGCTGATCCGCGGCGGTCATGTGGATGCCAGCGTACTGGGCGGCTTACAGGTGGATGAACAGGCCAACCTAGCCAACTGGGTGGTACCGGGAAAAATGGTGCCGGGTATGGGCGGCGCGATGGATCTCGTGACTGGTGCGCGCAAAGTGATCATAGCCATGGAACACTGTGCAAAAGACGGTTCCGCCAAAATCCTGCCGGAGTGCACCATGCCGCTGACCGCCGTGAAAGCGGTGGATGTGCTGGTAACGGAACTGGCGTTATTCCGCTTTGAAAACGATCAGATGATTTTGTGTGAATACGCGCCGGGTACGGATATCGATACTATCCGCGAAAAAACCGCCGCGCATTTTATTGTGTCACCGGCAATCTGTGAAATGCCGCTGGTGACTGCGGGGGAAGCCGTATGATAGGACGCATCTCACGAGTCATGACCCGTGTGGTGAGCCGCTATCTGCCG