Homologs in group_1440

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08550 FBDBKF_08550 100.0 Morganella morganii S1 ytfP putative gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family
EHELCC_12975 EHELCC_12975 100.0 Morganella morganii S2 ytfP putative gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family
NLDBIP_13315 NLDBIP_13315 100.0 Morganella morganii S4 ytfP putative gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family
HKOGLL_11790 HKOGLL_11790 100.0 Morganella morganii S5 ytfP putative gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family
F4V73_RS09775 F4V73_RS09775 93.3 Morganella psychrotolerans - gamma-glutamylcyclotransferase
PMI_RS16885 PMI_RS16885 78.3 Proteus mirabilis HI4320 - gamma-glutamylcyclotransferase

Distribution of the homologs in the orthogroup group_1440

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1440

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE51 2.27e-48 153 61 0 111 3 ytfP Gamma-glutamylcyclotransferase family protein YtfP Shigella flexneri
P0AE48 2.27e-48 153 61 0 111 1 ytfP Gamma-glutamylcyclotransferase family protein YtfP Escherichia coli (strain K12)
P0AE49 2.27e-48 153 61 0 111 3 ytfP Gamma-glutamylcyclotransferase family protein YtfP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE50 2.27e-48 153 61 0 111 3 ytfP Gamma-glutamylcyclotransferase family protein YtfP Escherichia coli O157:H7
D2TN58 3.4e-48 152 60 0 113 1 ytfP Gamma-glutamylcyclotransferase family protein ytfP Citrobacter rodentium (strain ICC168)
Q9KP33 1.71e-24 92 42 1 110 3 VC_2546 Putative gamma-glutamylcyclotransferase VC_2546 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O58558 6.94e-11 58 33 3 108 1 PH0828 Putative gamma-glutamylcyclotransferase PH0828 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9W0Y2 7.05e-05 43 30 5 123 2 CG2811 Putative gamma-glutamylcyclotransferase CG2811 Drosophila melanogaster
P39759 0.000122 43 31 6 119 1 ykqA Putative gamma-glutamylcyclotransferase YkqA Bacillus subtilis (strain 168)
Q4H4F0 0.000237 41 29 5 117 1 btrG Gamma-L-glutamyl-butirosin B gamma-glutamyl cyclotransferase Niallia circulans

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_13240
Feature type CDS
Gene ytfP
Product putative gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family
Location 92161 - 92523 (strand: 1)
Length 363 (nucleotides) / 120 (amino acids)
In genomic island -

Contig

Accession ZDB_370
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1440
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06094 Gamma-glutamyl cyclotransferase, AIG2-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2105 Amino acid transport and metabolism (E) E Predicted gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family

Protein Sequence

MRVIVYGSLRQKQGNHHWMTYAALLGEYTLEGYDLYDLGHYPAVVPGTGSIECEVYRISSSILTELDELKKDGQDYRRELVSTPYGSAWIYLYQRPVDGLVKINCGDWLKRHEADGPESE

Flanking regions ( +/- flanking 50bp)

CTGGTGTTAACCAGGCGATCGATCTGCTTTATCAGTTTGAGTTTTAATATATGCGAGTGATCGTTTATGGCAGTTTGCGGCAGAAACAGGGCAACCATCATTGGATGACCTATGCCGCCCTGCTGGGAGAATATACGCTTGAAGGCTATGACCTGTATGATTTGGGACACTATCCTGCGGTGGTACCGGGAACCGGTTCGATCGAATGTGAAGTGTACCGGATCTCCTCGTCGATCCTGACTGAGCTGGATGAATTAAAAAAAGATGGTCAGGATTACCGGCGTGAATTGGTTTCAACGCCGTACGGCAGTGCCTGGATTTACTTATATCAGCGTCCGGTGGACGGACTGGTGAAGATAAATTGCGGGGACTGGCTGAAACGGCACGAGGCAGATGGCCCGGAAAGCGAATGATTTCCCTGTGAATAAAAAAACCGCTGTGAAAACAGCGGTTTTTTTTGTCT