Homologs in group_1440

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08550 FBDBKF_08550 93.3 Morganella morganii S1 ytfP putative gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family
EHELCC_12975 EHELCC_12975 93.3 Morganella morganii S2 ytfP putative gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family
NLDBIP_13315 NLDBIP_13315 93.3 Morganella morganii S4 ytfP putative gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family
LHKJJB_13240 LHKJJB_13240 93.3 Morganella morganii S3 ytfP putative gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family
HKOGLL_11790 HKOGLL_11790 93.3 Morganella morganii S5 ytfP putative gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family
PMI_RS16885 PMI_RS16885 75.7 Proteus mirabilis HI4320 - gamma-glutamylcyclotransferase

Distribution of the homologs in the orthogroup group_1440

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1440

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE51 1.63e-45 146 59 0 111 3 ytfP Gamma-glutamylcyclotransferase family protein YtfP Shigella flexneri
P0AE48 1.63e-45 146 59 0 111 1 ytfP Gamma-glutamylcyclotransferase family protein YtfP Escherichia coli (strain K12)
P0AE49 1.63e-45 146 59 0 111 3 ytfP Gamma-glutamylcyclotransferase family protein YtfP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE50 1.63e-45 146 59 0 111 3 ytfP Gamma-glutamylcyclotransferase family protein YtfP Escherichia coli O157:H7
D2TN58 2.87e-45 145 59 0 111 1 ytfP Gamma-glutamylcyclotransferase family protein ytfP Citrobacter rodentium (strain ICC168)
Q9KP33 3.63e-24 92 41 1 110 3 VC_2546 Putative gamma-glutamylcyclotransferase VC_2546 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O58558 1.9e-11 59 35 3 108 1 PH0828 Putative gamma-glutamylcyclotransferase PH0828 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q4H4F0 3.44e-05 43 30 5 117 1 btrG Gamma-L-glutamyl-butirosin B gamma-glutamyl cyclotransferase Niallia circulans
Q9W0Y2 6.3e-05 43 30 5 123 2 CG2811 Putative gamma-glutamylcyclotransferase CG2811 Drosophila melanogaster

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS09775
Feature type CDS
Gene -
Product gamma-glutamylcyclotransferase
Location 59904 - 60266 (strand: 1)
Length 363 (nucleotides) / 120 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1440
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06094 Gamma-glutamyl cyclotransferase, AIG2-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2105 Amino acid transport and metabolism (E) E Predicted gamma-glutamylamine cyclotransferase YtfP, GGCT/AIG2-like family

Protein Sequence

MRVIVYGSLRQKQGNHHWMTYAALLGEYTLEGYDLYDLGHYPAVVPGTGKIECEVYRISSSILTELDELKKDGQDYRRELVSTPYGSAWIYLYQRSVDDLVRINCGDWLRRHGEPGPESE

Flanking regions ( +/- flanking 50bp)

CTGGCGTAAGCCAGGCGATCGATCTGCTTTATCAGTTTGAGTTCTAATATATGCGAGTGATCGTTTATGGCAGTTTGCGGCAAAAACAGGGAAACCATCACTGGATGACCTATGCCGCCCTGCTGGGTGAGTATACGCTTGAAGGTTATGATCTGTATGATCTGGGGCACTATCCTGCGGTTGTACCGGGAACCGGTAAAATCGAATGTGAAGTGTACCGGATCTCTTCGTCGATCCTGACAGAGCTGGATGAATTGAAAAAAGATGGTCAGGATTACCGGCGCGAGCTGGTTTCAACGCCTTATGGCAGCGCCTGGATTTACCTGTATCAGCGTTCTGTGGACGATTTGGTGCGGATAAACTGCGGTGACTGGCTCAGGCGTCACGGGGAACCGGGACCGGAAAGCGAATAACATACCTGCAAAAATAAAAAACCGCTGTGAAAACAGCGGTTTTTTTTATC