Homologs in group_1326

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08210 FBDBKF_08210 100.0 Morganella morganii S1 trxA thioredoxin TrxA
EHELCC_13315 EHELCC_13315 100.0 Morganella morganii S2 trxA thioredoxin TrxA
NLDBIP_13655 NLDBIP_13655 100.0 Morganella morganii S4 trxA thioredoxin TrxA
HKOGLL_12130 HKOGLL_12130 100.0 Morganella morganii S5 trxA thioredoxin TrxA
F4V73_RS18760 F4V73_RS18760 94.4 Morganella psychrotolerans trxA thioredoxin TrxA
PMI_RS16470 PMI_RS16470 75.9 Proteus mirabilis HI4320 trxA thioredoxin TrxA

Distribution of the homologs in the orthogroup group_1326

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1326

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AA30 3.91e-58 177 76 0 108 3 trxA Thioredoxin 1 Shigella flexneri
P0AA28 3.91e-58 177 76 0 108 1 trxA Thioredoxin 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA29 3.91e-58 177 76 0 108 1 trxA Thioredoxin 1 Salmonella typhi
P0AA25 3.91e-58 177 76 0 108 1 trxA Thioredoxin 1 Escherichia coli (strain K12)
P0AA26 3.91e-58 177 76 0 108 3 trxA Thioredoxin 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA27 3.91e-58 177 76 0 108 1 trxA Thioredoxin 1 Escherichia coli O157:H7
Q9X2T1 4.54e-53 164 66 0 108 3 trxA Thioredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52233 2.8e-51 160 65 0 108 3 trxA Thioredoxin Acidithiobacillus ferridurans
P09857 7.14e-50 156 64 0 106 1 trxA Thioredoxin Allochromatium vinosum
P57653 2.06e-44 142 60 0 106 3 trxA Thioredoxin Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O51890 1.69e-43 140 63 0 106 3 trxA Thioredoxin Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P43785 3.03e-43 139 58 0 105 3 trxA Thioredoxin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P96132 2.38e-42 137 67 0 91 3 trxA Thioredoxin (Fragment) Thiocapsa roseopersicina
P59527 9.21e-42 135 56 0 105 3 trxA Thioredoxin Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9CM49 2.02e-41 135 56 0 105 3 trxA Thioredoxin Pasteurella multocida (strain Pm70)
P10473 7.47e-40 130 53 0 102 1 trxA Thioredoxin Rhodospirillum rubrum
P33791 7.93e-40 130 54 0 103 3 trxA Thioredoxin (Fragment) Kitasatospora aureofaciens
P00275 2.93e-39 129 57 0 99 1 None Thioredoxin C-1 Corynebacterium nephridii
P0A4L2 3.51e-39 129 55 0 102 1 trxA Thioredoxin 1 Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A4L1 3.51e-39 129 55 0 102 3 trxA Thioredoxin 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P12243 5.81e-39 129 54 0 101 3 trxA Thioredoxin 1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P07887 7.45e-39 128 54 0 108 1 None Thioredoxin C-2 Corynebacterium nephridii
Q92JR5 7.16e-37 123 51 0 102 3 trxA Thioredoxin Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q4UNK3 7.99e-37 123 51 0 102 3 trxA Thioredoxin Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P52231 9.99e-37 123 51 0 102 1 trxA Thioredoxin Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P50254 1.19e-36 123 51 0 102 3 trxA Thioredoxin Neopyropia yezoensis
Q1RKN1 1.22e-36 122 50 0 102 3 trxA Thioredoxin Rickettsia bellii (strain RML369-C)
Q9ZEE0 3.91e-36 121 50 0 102 1 trxA Thioredoxin Rickettsia prowazekii (strain Madrid E)
Q7M1B9 6.16e-36 121 55 0 103 1 trxA Thioredoxin Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
P48384 1.48e-35 122 54 0 101 1 None Thioredoxin M-type, chloroplastic Pisum sativum
P51225 1.63e-35 120 50 0 102 3 trxA Thioredoxin Porphyra purpurea
Q9ZP21 5.33e-35 120 51 0 106 2 None Thioredoxin M-type, chloroplastic Triticum aestivum
P08058 5.33e-35 119 50 0 99 1 trxA Thioredoxin Cereibacter sphaeroides
P52230 5.68e-35 119 57 0 100 1 trxA Thioredoxin 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q41864 6.04e-35 120 50 0 106 2 TRM1 Thioredoxin M-type, chloroplastic Zea mays
Q9ZP20 6.16e-35 120 55 0 96 2 TRXM Thioredoxin M5, chloroplastic Oryza sativa subsp. japonica
Q8KE49 6.36e-35 118 50 0 108 3 trx2 Thioredoxin 2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9XGS0 6.86e-35 120 55 0 102 1 None Thioredoxin M-type, chloroplastic Brassica napus
P37395 1.33e-34 117 53 0 95 3 trxA Thioredoxin Cyanidium caldarium
Q68Y00 1.39e-34 117 49 0 102 3 trxA Thioredoxin Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P10472 7.82e-34 115 49 0 105 1 trxA Thioredoxin Chlorobaculum thiosulfatiphilum
P07591 1.16e-33 117 51 0 101 1 None Thioredoxin M-type, chloroplastic Spinacia oleracea
P80579 1.35e-33 115 53 1 96 1 trxA Thioredoxin Alicyclobacillus acidocaldarius subsp. acidocaldarius
Q9SEU8 3.46e-33 116 52 0 99 1 TRXM2 Thioredoxin M2, chloroplastic Arabidopsis thaliana
P9WG67 3.6e-33 114 55 0 95 1 trxA Thioredoxin Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG66 3.6e-33 114 55 0 95 3 trxA Thioredoxin Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A617 3.6e-33 114 55 0 95 3 trxA Thioredoxin Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O48737 4.24e-33 116 54 0 98 1 At1g03680 Thioredoxin M1, chloroplastic Arabidopsis thaliana
Q9SEU6 2.05e-31 112 45 0 103 2 At3g15360 Thioredoxin M4, chloroplastic Arabidopsis thaliana
P23400 6.26e-31 109 51 0 93 1 TRXM Thioredoxin M-type, chloroplastic Chlamydomonas reinhardtii
Q6H7E4 6.37e-31 110 45 0 107 2 Os02g0639900 Thioredoxin M1, chloroplastic Oryza sativa subsp. japonica
P50338 2.73e-30 107 50 0 96 3 trxA Thioredoxin Griffithsia pacifica
Q05739 7.12e-30 105 53 1 100 1 trxA Thioredoxin Streptomyces clavuligerus
O22022 8.84e-30 105 52 1 96 3 trxA Thioredoxin Cyanidioschyzon merolae (strain NIES-3377 / 10D)
P20857 1.52e-29 105 41 0 108 1 trxB Thioredoxin 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P66928 1.91e-29 104 51 1 96 1 trxA Thioredoxin Helicobacter pylori (strain ATCC 700392 / 26695)
P66929 1.91e-29 104 51 1 96 3 trxA Thioredoxin Helicobacter pylori (strain J99 / ATCC 700824)
Q7X8R5 3.05e-29 106 43 0 105 2 Os04g0530600 Thioredoxin M2, chloroplastic Oryza sativa subsp. japonica
Q8CPL5 3.37e-29 103 48 1 104 3 trxA Thioredoxin Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQ29 3.37e-29 103 48 1 104 3 trxA Thioredoxin Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P0A0K5 4.43e-29 103 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain MW2)
P0A0K6 4.43e-29 103 48 1 104 1 trxA Thioredoxin Staphylococcus aureus
Q6GA69 4.43e-29 103 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain MSSA476)
Q6GHU0 4.43e-29 103 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain MRSA252)
P99122 4.43e-29 103 48 1 104 1 trxA Thioredoxin Staphylococcus aureus (strain N315)
P0A0K4 4.43e-29 103 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGT9 4.43e-29 103 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain COL)
Q2YXD0 4.43e-29 103 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZD2 4.43e-29 103 48 1 104 2 trxA Thioredoxin Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHT6 4.43e-29 103 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain USA300)
Q4L5F0 6.49e-29 103 47 1 104 3 trxA Thioredoxin Staphylococcus haemolyticus (strain JCSC1435)
P14949 1.31e-28 102 46 1 104 1 trxA Thioredoxin Bacillus subtilis (strain 168)
P0A4L3 1.71e-28 102 44 1 102 3 trxA Thioredoxin Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4L4 1.71e-28 102 44 1 102 3 trxA Thioredoxin Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q49WR2 2.63e-28 101 47 1 104 3 trxA Thioredoxin Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O30974 4.84e-28 101 49 1 97 1 trxA Thioredoxin Mycolicibacterium smegmatis
P46843 5.42e-28 108 50 0 95 3 trxB/A Bifunctional thioredoxin reductase/thioredoxin Mycobacterium leprae (strain TN)
Q7XQQ2 6.4e-27 100 45 0 101 2 Os04g0430800 Thioredoxin M3, chloroplastic Oryza sativa subsp. japonica
Q7XKD0 6.96e-27 100 43 1 103 2 TRX-X Thioredoxin X, chloroplastic Oryza sativa subsp. japonica
Q8LD49 2.49e-25 96 41 1 104 2 ATHX Thioredoxin X, chloroplastic Arabidopsis thaliana
Q9SEU7 7.81e-24 92 42 0 95 2 GAT1 Thioredoxin M3, chloroplastic Arabidopsis thaliana
P73263 8.23e-24 90 41 0 92 1 slr1139 Thioredoxin-like protein slr1139 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8KEA4 1.27e-23 89 43 0 79 3 trx1 Thioredoxin 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
O83889 1.55e-23 89 40 0 93 3 trxA Thioredoxin Treponema pallidum (strain Nichols)
P52227 6.42e-23 88 47 1 88 3 trxA Thioredoxin Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
P0AGG7 7.11e-23 89 36 1 105 3 trxC Thioredoxin 2 Shigella flexneri
P0AGG4 7.11e-23 89 36 1 105 1 trxC Thioredoxin 2 Escherichia coli (strain K12)
P0AGG5 7.11e-23 89 36 1 105 3 trxC Thioredoxin 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGG6 7.11e-23 89 36 1 105 3 trxC Thioredoxin 2 Escherichia coli O157:H7
Q9PJK3 1.31e-22 87 48 1 88 3 trxA Thioredoxin Chlamydia muridarum (strain MoPn / Nigg)
Q9Z7P5 1.95e-22 87 48 1 88 3 trxA Thioredoxin Chlamydia pneumoniae
O84544 3.48e-22 86 46 1 88 3 trxA Thioredoxin Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P47370 1.65e-20 82 38 1 92 3 trxA Thioredoxin Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9R6P9 2.17e-20 81 35 1 98 3 trxA Thioredoxin Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q6NPF9 2.53e-20 83 37 0 96 1 At1g76760 Thioredoxin Y1, chloroplastic Arabidopsis thaliana
P52232 5.1e-20 80 45 0 73 1 slr0233 Thioredoxin-like protein slr0233 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8IFW4 5.59e-20 82 40 0 87 1 TrxT Thioredoxin-T Drosophila melanogaster
Q1RQI9 1.27e-19 79 48 1 72 1 None Thioredoxin (Fragment) Malassezia sympodialis
Q8L7S9 1.34e-19 81 37 0 96 2 At1g43560 Thioredoxin Y2, chloroplastic Arabidopsis thaliana
Q95108 2.36e-19 80 38 0 96 1 TXN2 Thioredoxin, mitochondrial Bos taurus
Q17424 2.84e-19 80 38 1 99 3 trx-2 Probable thioredoxin-2 Caenorhabditis elegans
P97493 5.41e-19 79 38 0 96 1 Txn2 Thioredoxin, mitochondrial Mus musculus
Q99757 6.22e-19 79 38 0 96 1 TXN2 Thioredoxin, mitochondrial Homo sapiens
P97615 6.64e-19 79 39 0 92 2 Txn2 Thioredoxin, mitochondrial Rattus norvegicus
Q5JMR9 5.3e-18 77 36 0 100 3 Os01g0963400 Thioredoxin Y, chloroplastic Oryza sativa subsp. japonica
G4NFB7 5.97e-18 77 38 2 103 1 TRX2 Thioredoxin-2 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
P29429 8.2e-18 75 43 1 82 1 TRX1 Thioredoxin Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q6XHI1 1.4e-17 74 38 2 91 3 Trx2 Thioredoxin-2 Drosophila yakuba
Q1RQJ0 4.56e-17 73 36 2 96 1 CDV57_00134 Thioredoxin Asp f 29 Aspergillus fumigatus
Q9V429 7.33e-17 72 37 2 91 1 Trx2 Thioredoxin-2 Drosophila melanogaster
P42115 2.55e-16 72 36 1 87 3 trx Thioredoxin Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
O48773 2.65e-16 76 36 0 102 2 PDIL2-3 Protein disulfide-isomerase 2-3 Arabidopsis thaliana
O48773 1.72e-09 56 30 1 99 2 PDIL2-3 Protein disulfide-isomerase 2-3 Arabidopsis thaliana
P80028 3.7e-16 71 41 1 87 1 TRXH Thioredoxin H-type Chlamydomonas reinhardtii
P21609 5.54e-16 70 39 0 82 1 trxA Thioredoxin Peptoclostridium litorale
Q1RQJ1 7.53e-16 70 39 1 68 1 None Thioredoxin Asp f 28 Aspergillus fumigatus
P34723 8.62e-16 70 39 1 73 1 TRXA Thioredoxin Penicillium chrysogenum
P52228 1.02e-15 70 36 2 91 3 None Thioredoxin C-3 Corynebacterium nephridii
Q9RD25 1.02e-15 70 36 2 99 2 trxC Putative thioredoxin 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P75512 1.04e-15 69 35 1 84 3 trxA Thioredoxin Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q0E0I1 1.88e-15 73 43 2 85 3 PDIL5-3 Protein disulfide isomerase-like 5-3 Oryza sativa subsp. japonica
Q9UW02 2.24e-15 68 34 2 86 1 None Thioredoxin Coprinus comatus
P22217 2.24e-15 68 41 2 86 1 TRX1 Thioredoxin-1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8TFM8 2.31e-15 69 37 1 83 1 None Thioredoxin-like protein Fusarium culmorum
Q9MAU6 3.22e-15 73 34 0 102 2 PDIL2-2 Protein disulfide-isomerase like 2-2 Arabidopsis thaliana
Q9MAU6 6.21e-10 58 30 2 101 2 PDIL2-2 Protein disulfide-isomerase like 2-2 Arabidopsis thaliana
O17486 7.65e-15 67 35 2 93 3 TRX Thioredoxin Echinococcus granulosus
Q0JD42 8.4e-15 71 45 2 86 2 PDIL5-2 Protein disulfide isomerase-like 5-2 Oryza sativa subsp. japonica
P22803 1.23e-14 67 32 2 98 1 TRX2 Thioredoxin-2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A2YIW7 1.31e-14 67 38 1 76 1 TRXH Thioredoxin H-type Oryza sativa subsp. indica
Q0D840 1.31e-14 67 38 1 76 1 TRXH Thioredoxin H1 Oryza sativa subsp. japonica
Q8JG64 1.37e-14 71 35 0 92 2 PDIA3 Protein disulfide-isomerase A3 Gallus gallus
Q8JG64 1.61e-06 48 34 2 69 2 PDIA3 Protein disulfide-isomerase A3 Gallus gallus
P21610 1.94e-14 66 36 0 85 1 trxA Thioredoxin Peptoclostridium acidaminophilum
Q67UF5 1.95e-14 70 39 0 81 2 PDIL2-3 Protein disulfide isomerase-like 2-3 Oryza sativa subsp. japonica
Q67UF5 2.6e-08 53 31 0 77 2 PDIL2-3 Protein disulfide isomerase-like 2-3 Oryza sativa subsp. japonica
Q39362 2.3e-14 66 35 0 76 2 THL-2 Thioredoxin H-type 2 Brassica napus
Q9USR1 5.43e-14 68 39 1 71 4 txl1 Thioredoxin-like protein 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q7KQL8 6.07e-14 65 35 2 90 1 TRX1 Thioredoxin 1 Plasmodium falciparum (isolate 3D7)
P38657 6.63e-14 69 38 1 83 2 PDIA3 Protein disulfide-isomerase A3 Bos taurus
P38657 5.38e-07 49 36 2 69 2 PDIA3 Protein disulfide-isomerase A3 Bos taurus
O64394 6.72e-14 65 37 2 83 2 None Thioredoxin H-type Triticum aestivum
P81109 8.89e-14 65 34 0 81 1 trxA Thioredoxin Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / CCUG 9281 / NCIMB 10654 / HF)
Q39239 1.07e-13 65 34 0 76 1 TRX4 Thioredoxin H4 Arabidopsis thaliana
O14463 1.15e-13 64 34 1 88 3 trx1 Thioredoxin-1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q869Z0 1.15e-13 68 35 0 78 1 DDB_G0275025 Putative protein disulfide-isomerase DDB_G0275025 Dictyostelium discoideum
Q4VIT4 1.32e-13 68 39 1 83 1 PDIA3 Protein disulfide-isomerase A3 Chlorocebus aethiops
Q4VIT4 2.5e-07 50 36 2 69 1 PDIA3 Protein disulfide-isomerase A3 Chlorocebus aethiops
P25372 1.38e-13 65 33 1 90 1 TRX3 Thioredoxin-3, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P11598 1.44e-13 68 39 1 83 1 Pdia3 Protein disulfide-isomerase A3 Rattus norvegicus
P11598 9.28e-06 46 33 2 69 1 Pdia3 Protein disulfide-isomerase A3 Rattus norvegicus
P27773 1.44e-13 68 39 1 83 1 Pdia3 Protein disulfide-isomerase A3 Mus musculus
P27773 5.55e-06 46 33 2 69 1 Pdia3 Protein disulfide-isomerase A3 Mus musculus
Q5RDG4 1.99e-13 67 38 1 83 2 PDIA3 Protein disulfide-isomerase A3 Pongo abelii
Q5RDG4 2.5e-07 50 36 2 69 2 PDIA3 Protein disulfide-isomerase A3 Pongo abelii
P30101 1.99e-13 67 38 1 83 1 PDIA3 Protein disulfide-isomerase A3 Homo sapiens
P30101 2.5e-07 50 36 2 69 1 PDIA3 Protein disulfide-isomerase A3 Homo sapiens
C9K7C5 2.37e-13 64 40 2 83 2 AMT13 Thioredoxin AMT13 Alternaria alternata
Q75M08 2.54e-13 67 39 1 83 2 PDIL2-1 Protein disulfide isomerase-like 2-1 Oryza sativa subsp. japonica
Q75M08 1.78e-11 62 35 2 85 2 PDIL2-1 Protein disulfide isomerase-like 2-1 Oryza sativa subsp. japonica
Q9V438 2.65e-13 67 36 0 88 1 CaBP1 Protein disulfide-isomerase A6 homolog Drosophila melanogaster
Q9V438 6.64e-13 66 34 0 81 1 CaBP1 Protein disulfide-isomerase A6 homolog Drosophila melanogaster
Q17967 3.8e-13 67 41 2 87 3 pdi-1 Protein disulfide-isomerase 1 Caenorhabditis elegans
Q17967 7.98e-07 49 30 0 78 3 pdi-1 Protein disulfide-isomerase 1 Caenorhabditis elegans
P38660 3.82e-13 67 32 2 111 1 PDIA6 Protein disulfide-isomerase A6 Mesocricetus auratus
P38660 2.55e-11 62 33 0 81 1 PDIA6 Protein disulfide-isomerase A6 Mesocricetus auratus
Q00216 4.37e-13 66 36 2 84 2 tigA Protein disulfide-isomerase tigA Aspergillus niger
Q00216 4.27e-08 52 32 4 106 2 tigA Protein disulfide-isomerase tigA Aspergillus niger
Q5R6T1 5.82e-13 66 36 1 85 2 PDIA6 Protein disulfide-isomerase A6 Pongo abelii
Q5R6T1 1.56e-10 59 32 0 81 2 PDIA6 Protein disulfide-isomerase A6 Pongo abelii
Q15084 5.93e-13 66 36 1 85 1 PDIA6 Protein disulfide-isomerase A6 Homo sapiens
Q15084 1.54e-10 59 32 0 81 1 PDIA6 Protein disulfide-isomerase A6 Homo sapiens
Q92249 6.09e-13 66 43 2 78 2 erp38 Protein disulfide-isomerase erp38 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q92249 1.22e-08 54 36 3 87 2 erp38 Protein disulfide-isomerase erp38 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
O51088 6.38e-13 63 32 0 64 3 trxA Thioredoxin Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q43636 6.53e-13 63 34 2 88 3 None Thioredoxin H-type Ricinus communis
P50413 8e-13 62 32 3 96 3 TXN Thioredoxin Ovis aries
O96952 8.83e-13 62 33 2 100 3 THIO Thioredoxin Geodia cydonium
Q38879 9.32e-13 63 36 1 69 1 TRX2 Thioredoxin H2 Arabidopsis thaliana
Q942L2 9.91e-13 65 33 3 106 2 PDIL2-2 Protein disulfide isomerase-like 2-2 Oryza sativa subsp. japonica
Q942L2 1.9e-12 65 41 1 75 2 PDIL2-2 Protein disulfide isomerase-like 2-2 Oryza sativa subsp. japonica
P29447 1.31e-12 62 30 3 105 3 trxC Thioredoxin-3 Dictyostelium discoideum
P08629 1.43e-12 61 33 3 92 3 TXN Thioredoxin Gallus gallus
P77395 1.46e-12 65 36 2 87 1 cnoX Chaperedoxin Escherichia coli (strain K12)
Q91W90 1.83e-12 65 33 3 103 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
Q91W90 2.2e-08 53 32 2 83 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
Q91W90 4.32e-07 49 33 1 65 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
P29445 1.88e-12 61 30 5 109 1 trxA Thioredoxin-1 Dictyostelium discoideum
Q9BDJ3 2.6e-12 61 32 3 96 3 TXN Thioredoxin Callithrix jacchus
P82460 2.68e-12 61 32 3 96 1 TXN Thioredoxin Sus scrofa
P10599 2.99e-12 60 34 3 94 1 TXN Thioredoxin Homo sapiens
O97680 3.06e-12 60 32 3 96 3 TXN Thioredoxin Bos taurus
Q86IA3 3.14e-12 64 36 2 97 1 pdi1 Protein disulfide-isomerase 1 Dictyostelium discoideum
Q86IA3 2.98e-11 61 38 3 89 1 pdi1 Protein disulfide-isomerase 1 Dictyostelium discoideum
P47938 3.34e-12 60 29 0 71 1 dhd Thioredoxin-1 Drosophila melanogaster
Q922R8 3.6e-12 64 34 0 81 1 Pdia6 Protein disulfide-isomerase A6 Mus musculus
Q922R8 3.74e-12 64 30 2 111 1 Pdia6 Protein disulfide-isomerase A6 Mus musculus
Q63081 3.67e-12 64 30 2 111 1 Pdia6 Protein disulfide-isomerase A6 Rattus norvegicus
Q63081 1.9e-11 62 33 0 81 1 Pdia6 Protein disulfide-isomerase A6 Rattus norvegicus
Q9LKW0 3.86e-12 62 33 2 92 1 CITRX Thioredoxin-like protein CITRX, chloroplastic Solanum lycopersicum
Q9TW67 4.74e-12 63 37 2 75 1 png-1 Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase Caenorhabditis elegans
O97508 5.19e-12 60 30 3 97 3 TXN Thioredoxin Equus caballus
Q09433 5.26e-12 60 35 2 76 1 trx-1 Thioredoxin-1 Caenorhabditis elegans
Q498R3 5.45e-12 63 36 0 77 2 Dnajc10 DnaJ homolog subfamily C member 10 Rattus norvegicus
Q498R3 2.84e-06 47 29 1 84 2 Dnajc10 DnaJ homolog subfamily C member 10 Rattus norvegicus
Q498R3 1.8e-05 45 29 0 79 2 Dnajc10 DnaJ homolog subfamily C member 10 Rattus norvegicus
P38661 5.68e-12 63 37 1 83 2 None Probable protein disulfide-isomerase A6 Medicago sativa
P38661 1.42e-10 59 31 3 101 2 None Probable protein disulfide-isomerase A6 Medicago sativa
P29451 6.87e-12 60 32 2 83 3 TXN Thioredoxin Macaca mulatta
Q9DC23 8.53e-12 63 35 0 78 1 Dnajc10 DnaJ homolog subfamily C member 10 Mus musculus
Q9DC23 4.32e-06 47 28 1 84 1 Dnajc10 DnaJ homolog subfamily C member 10 Mus musculus
Q9DC23 2.93e-05 44 29 0 79 1 Dnajc10 DnaJ homolog subfamily C member 10 Mus musculus
Q9DC23 0.001 40 24 1 89 1 Dnajc10 DnaJ homolog subfamily C member 10 Mus musculus
M1A3D5 1.13e-11 61 34 1 90 3 CITRX Thioredoxin-like protein CITRX, chloroplastic Solanum tuberosum
O22263 1.25e-11 62 37 1 80 2 PDIL2-1 Protein disulfide-isomerase like 2-1 Arabidopsis thaliana
O22263 2.94e-11 61 38 2 80 2 PDIL2-1 Protein disulfide-isomerase like 2-1 Arabidopsis thaliana
Q42403 1.41e-11 59 31 1 74 1 TRX3 Thioredoxin H3 Arabidopsis thaliana
Q11067 1.54e-11 62 36 0 83 3 pdi-6 Protein disulfide-isomerase A6 homolog Caenorhabditis elegans
Q11067 1.64e-08 53 27 0 80 3 pdi-6 Protein disulfide-isomerase A6 homolog Caenorhabditis elegans
P11232 1.79e-11 58 33 3 92 1 Txn Thioredoxin Rattus norvegicus
P10639 1.81e-11 58 33 3 92 1 Txn Thioredoxin Mus musculus
Q43116 1.92e-11 62 38 3 94 2 None Protein disulfide-isomerase Ricinus communis
Q43116 1.74e-06 48 34 2 67 2 None Protein disulfide-isomerase Ricinus communis
P29828 1.98e-11 62 37 3 97 2 PDI Protein disulfide-isomerase Medicago sativa
P29828 1.36e-06 48 29 3 86 2 PDI Protein disulfide-isomerase Medicago sativa
Q93VQ9 2.01e-11 60 32 4 109 1 At1g31020 Thioredoxin O2, mitochondrial Arabidopsis thaliana
P60226 2.36e-11 58 28 1 83 2 dhd Thioredoxin-1 Drosophila yakuba
P08628 2.65e-11 58 31 3 94 1 TXN Thioredoxin Oryctolagus cuniculus
Q4N4N8 2.71e-11 60 28 1 105 1 TP02_0602 Thioredoxin domain-containing protein Theileria parva
Q6JE37 2.93e-11 60 40 0 61 1 CITRX2 Thioredoxin-like protein CITRX2, chloroplastic Nicotiana benthamiana
Q5WNE3 3.19e-11 61 37 2 75 3 png-1 Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase Caenorhabditis briggsae
Q5R9M3 3.22e-11 58 31 2 94 3 TXN Thioredoxin Pongo abelii
P29449 3.4e-11 58 34 1 83 2 None Thioredoxin H-type 1 Nicotiana tabacum
O64764 4.03e-11 60 37 3 85 1 At2g35010 Thioredoxin O1, mitochondrial Arabidopsis thaliana
Q96419 4.94e-11 58 32 1 71 3 None Thioredoxin H-type Fagopyrum esculentum
Q9M7X9 5.86e-11 59 34 2 91 1 CITRX Thioredoxin-like protein CITRX, chloroplastic Arabidopsis thaliana
Q6JE38 6.06e-11 59 40 0 61 2 CITRX1 Thioredoxin-like protein CITRX1, chloroplastic Nicotiana benthamiana
A0A509AQW5 6.16e-11 58 28 0 88 1 TRX2 Thioredoxin 2 Plasmodium berghei (strain Anka)
Q70G58 6.5e-11 60 32 0 84 1 Os07g0657900 Thioredoxin reductase NTRC Oryza sativa subsp. japonica
Q8H2V6 6.67e-11 59 32 1 88 2 Os08g0378900 Thioredoxin-like protein CITRX, chloroplastic Oryza sativa subsp. japonica
A2YUQ6 6.81e-11 59 32 1 88 3 OsI_29059 Thioredoxin-like protein CITRX, chloroplastic Oryza sativa subsp. indica
Q8NBS9 6.85e-11 60 31 3 103 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
Q8NBS9 2.49e-08 53 34 2 83 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
Q8NBS9 1.71e-07 50 35 1 65 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
O94504 6.93e-11 58 34 1 81 1 trx2 Thioredoxin-2, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P09103 7.09e-11 60 37 2 86 1 P4hb Protein disulfide-isomerase Mus musculus
P09103 9.02e-07 48 30 0 75 1 P4hb Protein disulfide-isomerase Mus musculus
P09102 7.1e-11 60 36 2 86 1 P4HB Protein disulfide-isomerase Gallus gallus
P09102 2.95e-08 53 34 0 73 1 P4HB Protein disulfide-isomerase Gallus gallus
P21195 7.3e-11 60 37 2 86 2 P4HB Protein disulfide-isomerase Oryctolagus cuniculus
P21195 3.65e-07 50 31 0 73 2 P4HB Protein disulfide-isomerase Oryctolagus cuniculus
Q851R5 9.95e-11 57 31 2 92 2 Os03g0800700 Thioredoxin H2-2 Oryza sativa subsp. japonica
Q07090 1.06e-10 57 34 2 85 3 None Thioredoxin H-type 2 Nicotiana tabacum
P29448 1.12e-10 57 31 3 103 1 TRX1 Thioredoxin H1 Arabidopsis thaliana
Q5R5L3 1.66e-10 59 34 0 75 2 DNAJC10 DnaJ homolog subfamily C member 10 Pongo abelii
Q5R5L3 1.03e-05 46 28 1 84 2 DNAJC10 DnaJ homolog subfamily C member 10 Pongo abelii
Q5R5L3 4.62e-05 44 25 1 93 2 DNAJC10 DnaJ homolog subfamily C member 10 Pongo abelii
Q5R5L3 6.75e-05 43 27 0 79 2 DNAJC10 DnaJ homolog subfamily C member 10 Pongo abelii
Q8IXB1 1.66e-10 59 34 0 75 1 DNAJC10 DnaJ homolog subfamily C member 10 Homo sapiens
Q8IXB1 1.03e-05 46 28 1 84 1 DNAJC10 DnaJ homolog subfamily C member 10 Homo sapiens
Q8IXB1 6.75e-05 43 27 0 79 1 DNAJC10 DnaJ homolog subfamily C member 10 Homo sapiens
Q8IXB1 0.000157 42 25 1 84 1 DNAJC10 DnaJ homolog subfamily C member 10 Homo sapiens
Q9XF61 1.73e-10 59 35 3 98 2 PDI Protein disulfide-isomerase Datisca glomerata
Q9XF61 1.8e-06 48 30 3 86 2 PDI Protein disulfide-isomerase Datisca glomerata
Q8VX13 1.74e-10 59 33 0 84 2 PDIL1-3 Protein disulfide isomerase-like 1-3 Arabidopsis thaliana
Q8VX13 7.04e-06 46 28 0 73 2 PDIL1-3 Protein disulfide isomerase-like 1-3 Arabidopsis thaliana
P07237 1.93e-10 59 36 2 86 1 P4HB Protein disulfide-isomerase Homo sapiens
P07237 1.23e-06 48 31 0 70 1 P4HB Protein disulfide-isomerase Homo sapiens
Q2HWU2 2.01e-10 59 36 2 86 2 P4HB Protein disulfide-isomerase Macaca fuscata fuscata
Q2HWU2 7.13e-08 52 32 0 74 2 P4HB Protein disulfide-isomerase Macaca fuscata fuscata
Q5R5B6 2.06e-10 59 36 2 86 2 P4HB Protein disulfide-isomerase Pongo abelii
Q5R5B6 1.32e-06 48 31 0 70 2 P4HB Protein disulfide-isomerase Pongo abelii
P05307 2.07e-10 59 36 2 86 1 P4HB Protein disulfide-isomerase Bos taurus
P05307 6.42e-07 49 31 0 70 1 P4HB Protein disulfide-isomerase Bos taurus
Q39241 2.25e-10 56 30 2 89 1 TRX5 Thioredoxin H5 Arabidopsis thaliana
Q94F09 2.53e-10 58 41 2 85 1 PDIL5-2 Protein disulfide-isomerase 5-2 Arabidopsis thaliana
O65049 2.99e-10 56 32 1 80 2 SB09 Thioredoxin H-type Picea mariana
Q54EN4 3.05e-10 58 34 1 82 3 pdi2 Protein disulfide-isomerase 2 Dictyostelium discoideum
Q54EN4 5.52e-10 58 40 3 76 3 pdi2 Protein disulfide-isomerase 2 Dictyostelium discoideum
Q10057 3.16e-10 58 31 4 110 3 SPAC1F5.02 Putative protein disulfide-isomerase C1F5.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q10057 8.36e-09 54 35 1 71 3 SPAC1F5.02 Putative protein disulfide-isomerase C1F5.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O22229 3.24e-10 58 30 0 84 1 NTRC NADPH-dependent thioredoxin reductase 3 Arabidopsis thaliana
Q6Z4I3 3.27e-10 56 32 2 82 2 Os07g0190800 Thioredoxin H2-1 Oryza sativa subsp. japonica
P29446 3.43e-10 55 29 2 82 2 trxB Thioredoxin-2 (Fragment) Dictyostelium discoideum
Q8R4U2 3.6e-10 58 36 2 86 2 P4HB Protein disulfide-isomerase Cricetulus griseus
Q8R4U2 1.13e-06 48 31 0 70 2 P4HB Protein disulfide-isomerase Cricetulus griseus
Q69AB2 3.7e-10 56 38 1 63 1 Txndc8 Thioredoxin domain-containing protein 8 Mus musculus
P04785 3.81e-10 58 36 2 86 1 P4hb Protein disulfide-isomerase Rattus norvegicus
P04785 8.1e-07 49 31 0 70 1 P4hb Protein disulfide-isomerase Rattus norvegicus
P09856 4.21e-10 57 38 3 81 1 None Thioredoxin F-type, chloroplastic Spinacia oleracea
Q12404 5.05e-10 58 33 1 81 1 MPD1 Protein disulfide-isomerase MPD1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q17770 5.13e-10 58 34 2 87 1 pdi-2 Protein disulfide-isomerase 2 Caenorhabditis elegans
Q17770 1.44e-07 51 32 0 76 1 pdi-2 Protein disulfide-isomerase 2 Caenorhabditis elegans
Q69AB1 5.79e-10 55 34 1 66 2 Txndc8 Thioredoxin domain-containing protein 8 Rattus norvegicus
P12865 6e-10 58 29 1 103 3 BS2 Bloodstream-specific protein 2 Trypanosoma brucei brucei
P12865 2.97e-06 47 31 1 72 3 BS2 Bloodstream-specific protein 2 Trypanosoma brucei brucei
P34329 6.58e-10 57 36 2 85 3 C14B9.2 Probable protein disulfide-isomerase A4 Caenorhabditis elegans
P34329 3.76e-07 50 29 2 86 3 C14B9.2 Probable protein disulfide-isomerase A4 Caenorhabditis elegans
Q9VYV3 8.22e-10 57 28 2 107 1 prtp Thioredoxin domain-containing protein 5 homolog Drosophila melanogaster
Q9VYV3 5.83e-08 52 28 3 97 1 prtp Thioredoxin domain-containing protein 5 homolog Drosophila melanogaster
Q9VYV3 4.71e-07 49 36 2 83 1 prtp Thioredoxin domain-containing protein 5 homolog Drosophila melanogaster
Q1ZXE0 8.39e-10 54 31 2 83 3 trxD Putative thioredoxin-4 Dictyostelium discoideum
Q9XI01 8.95e-10 57 32 2 102 1 PDIL1-1 Protein disulfide isomerase-like 1-1 Arabidopsis thaliana
Q9XI01 6.99e-07 49 32 2 67 1 PDIL1-1 Protein disulfide isomerase-like 1-1 Arabidopsis thaliana
P96611 9.87e-10 54 30 2 95 2 ydbP Thioredoxin-like protein YdbP Bacillus subtilis (strain 168)
Q98TX1 1.01e-09 54 30 2 81 3 TXN Thioredoxin Ophiophagus hannah
Q5UR25 1.05e-09 57 28 3 111 1 MIMI_R362 Thioredoxin domain-containing protein R362 Acanthamoeba polyphaga mimivirus
Q8IDP4 1.23e-09 55 26 0 88 1 TRX2 Thioredoxin 2 Plasmodium falciparum (isolate 3D7)
P73920 1.29e-09 55 38 4 78 3 txlA Thiol:disulfide interchange protein TxlA homolog Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P08003 1.89e-09 56 31 2 101 1 Pdia4 Protein disulfide-isomerase A4 Mus musculus
P08003 4.32e-08 52 35 1 65 1 Pdia4 Protein disulfide-isomerase A4 Mus musculus
P08003 7.6e-06 46 32 2 81 1 Pdia4 Protein disulfide-isomerase A4 Mus musculus
D4B2L8 2.08e-09 56 34 5 108 3 ARB_02626 Protein disulfide-isomerase Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
D4B2L8 4.65e-09 55 35 1 70 3 ARB_02626 Protein disulfide-isomerase Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
Q9DGI3 2.46e-09 53 28 3 106 3 txn Thioredoxin Ictalurus punctatus
Q8S091 2.56e-09 55 37 3 81 2 Os01g0913000 Thioredoxin F, chloroplastic Oryza sativa subsp. japonica
P54399 2.68e-09 56 39 1 74 2 Pdi Protein disulfide-isomerase Drosophila melanogaster
P54399 4.16e-09 55 35 0 76 2 Pdi Protein disulfide-isomerase Drosophila melanogaster
P29450 2.69e-09 55 36 2 72 2 None Thioredoxin F-type, chloroplastic Pisum sativum
P55059 3.17e-09 55 35 2 80 1 None Protein disulfide-isomerase Humicola insolens
P55059 3.95e-06 47 31 4 102 1 None Protein disulfide-isomerase Humicola insolens
O48897 3.21e-09 54 36 3 83 2 TRXF Thioredoxin F-type, chloroplastic Brassica napus
Q9SRG3 4.25e-09 55 31 1 93 2 PDIL1-2 Protein disulfide isomerase-like 1-2 Arabidopsis thaliana
Q9SRG3 8.75e-07 48 30 3 86 2 PDIL1-2 Protein disulfide isomerase-like 1-2 Arabidopsis thaliana
Q9FF55 4.32e-09 55 34 2 93 1 PDIL1-4 Protein disulfide isomerase-like 1-4 Arabidopsis thaliana
Q9FF55 3.47e-05 44 27 0 73 1 PDIL1-4 Protein disulfide isomerase-like 1-4 Arabidopsis thaliana
Q9XFH9 4.61e-09 54 38 3 81 1 At5g16400 Thioredoxin F2, chloroplastic Arabidopsis thaliana
Q50KB1 6.39e-09 54 28 2 107 1 SEP2 Protein disulfide-isomerase-like protein EhSep2 Emiliania huxleyi
P13667 7.43e-09 55 32 1 75 1 PDIA4 Protein disulfide-isomerase A4 Homo sapiens
P13667 2.32e-07 50 34 2 81 1 PDIA4 Protein disulfide-isomerase A4 Homo sapiens
P13667 2.37e-06 47 32 2 84 1 PDIA4 Protein disulfide-isomerase A4 Homo sapiens
P80284 8.74e-09 54 32 2 93 1 PDI Protein disulfide-isomerase Hordeum vulgare
P80284 2e-07 50 37 2 67 1 PDI Protein disulfide-isomerase Hordeum vulgare
Q12730 9.92e-09 54 35 3 99 2 pdiA Protein disulfide-isomerase Aspergillus niger
Q12730 1.15e-08 54 36 2 80 2 pdiA Protein disulfide-isomerase Aspergillus niger
P52589 1.01e-08 54 31 1 92 2 PDI Protein disulfide-isomerase Triticum aestivum
P52589 1.22e-07 51 37 2 67 2 PDI Protein disulfide-isomerase Triticum aestivum
Q7Y0D4 1.21e-08 53 29 3 95 2 Os03g0767500 Thioredoxin-like protein HCF164, chloroplastic Oryza sativa subsp. japonica
P68570 1.52e-08 52 28 2 97 3 bdbA Disulfide bond formation protein A Bacillus phage SPbeta
P68569 1.52e-08 52 28 2 97 3 bdbA SPbeta prophage-derived disulfide bond formation protein A Bacillus subtilis (strain 168)
Q29RV1 1.57e-08 53 32 1 75 2 PDIA4 Protein disulfide-isomerase A4 Bos taurus
Q29RV1 2.26e-06 47 32 2 84 2 PDIA4 Protein disulfide-isomerase A4 Bos taurus
Q29RV1 7.46e-06 46 33 2 81 2 PDIA4 Protein disulfide-isomerase A4 Bos taurus
Q9AS75 1.63e-08 52 33 1 71 2 Os01g0168200 Thioredoxin H4-1 Oryza sativa subsp. japonica
O64432 1.79e-08 51 28 2 84 2 PEC-2 Thioredoxin H-type Brassica campestris
Q9XFH8 1.84e-08 52 37 3 83 1 At3g02730 Thioredoxin F1, chloroplastic Arabidopsis thaliana
O13811 1.92e-08 53 33 1 72 3 SPAC17H9.14c Protein disulfide-isomerase C17H9.14c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O13811 6.06e-05 43 26 1 84 3 SPAC17H9.14c Protein disulfide-isomerase C17H9.14c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O23166 1.98e-08 53 30 3 97 1 HCF164 Thioredoxin-like protein HCF164, chloroplastic Arabidopsis thaliana
P68176 2.08e-08 51 28 2 84 2 BOPC17 Thioredoxin H-type Brassica oleracea
P68177 2.08e-08 51 28 2 84 2 THL-1 Thioredoxin H-type 1 Brassica napus
O81332 2.32e-08 52 35 3 82 2 None Thioredoxin F-type, chloroplastic Mesembryanthemum crystallinum
P38658 2.46e-08 53 34 2 85 3 None Probable protein disulfide-isomerase ER-60 Schistosoma mansoni
P38658 0.000385 41 29 1 74 3 None Probable protein disulfide-isomerase ER-60 Schistosoma mansoni
Q5R875 3.05e-08 53 37 1 62 2 TMX3 Protein disulfide-isomerase TMX3 Pongo abelii
Q8BXZ1 3.05e-08 53 37 1 62 1 Tmx3 Protein disulfide-isomerase TMX3 Mus musculus
Q96JJ7 3.29e-08 53 37 1 62 1 TMX3 Protein disulfide-isomerase TMX3 Homo sapiens
P38659 3.39e-08 53 32 1 75 1 Pdia4 Protein disulfide-isomerase A4 Rattus norvegicus
P38659 1.31e-07 51 34 2 81 1 Pdia4 Protein disulfide-isomerase A4 Rattus norvegicus
P38659 6.58e-06 46 32 2 81 1 Pdia4 Protein disulfide-isomerase A4 Rattus norvegicus
Q9LXZ8 3.91e-08 51 31 4 94 3 At3g56420 Putative thioredoxin H10 Arabidopsis thaliana
P52588 5.33e-08 52 38 2 67 2 PDI Protein disulfide-isomerase Zea mays
P52588 1.83e-06 48 35 3 77 2 PDI Protein disulfide-isomerase Zea mays
O31820 5.56e-08 51 26 4 119 3 yneN Thioredoxin-like protein YneN Bacillus subtilis (strain 168)
Q14554 6.06e-08 52 36 2 85 1 PDIA5 Protein disulfide-isomerase A5 Homo sapiens
Q14554 1.34e-07 51 28 2 84 1 PDIA5 Protein disulfide-isomerase A5 Homo sapiens
Q14554 0.000458 41 30 3 85 1 PDIA5 Protein disulfide-isomerase A5 Homo sapiens
Q00248 6.23e-08 52 33 2 80 3 pdiA Protein disulfide-isomerase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q00248 3.16e-07 50 35 4 95 3 pdiA Protein disulfide-isomerase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P85801 6.49e-08 50 33 1 71 1 None Thioredoxin H-type Populus jackii
Q53LQ0 7.2e-08 52 40 2 67 2 PDIL1-1 Protein disulfide isomerase-like 1-1 Oryza sativa subsp. japonica
Q53LQ0 1.4e-07 51 36 3 77 2 PDIL1-1 Protein disulfide isomerase-like 1-1 Oryza sativa subsp. japonica
Q5RCH2 7.29e-08 52 33 1 71 2 PDIA2 Protein disulfide-isomerase A2 Pongo abelii
Q5RCH2 4.33e-06 47 34 2 75 2 PDIA2 Protein disulfide-isomerase A2 Pongo abelii
Q75GM1 7.64e-08 50 29 1 71 2 Os05g0480200 Thioredoxin H5 Oryza sativa subsp. japonica
Q9XIF4 8.68e-08 50 33 2 75 2 TRX7 Thioredoxin H7 Arabidopsis thaliana
Q5I0H9 9.2e-08 52 35 2 89 2 Pdia5 Protein disulfide-isomerase A5 Rattus norvegicus
Q5I0H9 4.19e-07 50 28 2 84 2 Pdia5 Protein disulfide-isomerase A5 Rattus norvegicus
Q2KIL5 9.2e-08 52 28 2 84 2 PDIA5 Protein disulfide-isomerase A5 Bos taurus
Q2KIL5 1.16e-06 48 35 2 85 2 PDIA5 Protein disulfide-isomerase A5 Bos taurus
Q921X9 1.24e-07 51 28 2 84 1 Pdia5 Protein disulfide-isomerase A5 Mus musculus
Q921X9 1.32e-07 51 35 2 89 1 Pdia5 Protein disulfide-isomerase A5 Mus musculus
P81110 1.29e-07 47 56 0 37 1 trxA Thioredoxin (Fragment) Tissierella creatinophila
Q0DKF1 1.59e-07 49 34 1 61 2 Os05g0169000 Thioredoxin H4-2 Oryza sativa subsp. japonica
Q9C9Y6 1.67e-07 49 29 1 71 1 TRX9 Thioredoxin H9 Arabidopsis thaliana
Q54KN7 2.49e-07 48 32 2 76 3 trxE Putative thioredoxin-5 Dictyostelium discoideum
O13704 2.49e-07 50 35 2 78 4 SPAC13F5.05 Thioredoxin domain-containing protein C13F5.05, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q6NRT6 3.8e-07 50 32 0 75 2 dnajc10 DnaJ homolog subfamily C member 10 Xenopus laevis
Q6NRT6 1.18e-05 45 30 0 79 2 dnajc10 DnaJ homolog subfamily C member 10 Xenopus laevis
Q6NRT6 4.36e-05 44 27 1 80 2 dnajc10 DnaJ homolog subfamily C member 10 Xenopus laevis
Q6NRT6 0.000462 41 32 0 58 2 dnajc10 DnaJ homolog subfamily C member 10 Xenopus laevis
O76003 4.02e-07 50 32 2 73 1 GLRX3 Glutaredoxin-3 Homo sapiens
Q9FG36 4.08e-07 49 29 1 72 2 WCRKC1 Thioredoxin-like 3-1, chloroplastic Arabidopsis thaliana
Q8VWG7 4.64e-07 49 29 1 71 1 TDX TPR repeat-containing thioredoxin TDX Arabidopsis thaliana
Q58DA7 4.65e-07 49 31 2 73 2 GLRX3 Glutaredoxin-3 Bos taurus
P17967 5.3e-07 49 38 3 89 1 PDI1 Protein disulfide-isomerase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P17967 2.41e-06 47 35 2 80 1 PDI1 Protein disulfide-isomerase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q3T0L2 5.76e-07 49 36 2 69 2 ERP44 Endoplasmic reticulum resident protein 44 Bos taurus
Q6GNG3 6.9e-07 49 35 1 62 2 tmx3 Protein disulfide-isomerase TMX3 Xenopus laevis
Q6DFS0 6.99e-07 49 25 5 117 2 tmx2 Thioredoxin-related transmembrane protein 2 Xenopus tropicalis
Q8LCH9 7.6e-07 47 26 2 78 2 At3g53220 Thioredoxin-like 3-3 Arabidopsis thaliana
Q6Z7L3 7.92e-07 48 34 2 72 3 Os02g0774100 Thioredoxin-like 3-1, chloroplastic Oryza sativa subsp. japonica
Q5UR29 8.13e-07 47 33 2 69 3 MIMI_R548 Thioredoxin-like protein R548 Acanthamoeba polyphaga mimivirus
Q58E26 9.48e-07 48 26 5 117 2 tmx2 Thioredoxin-related transmembrane protein 2 Xenopus laevis
Q9D1Q6 9.64e-07 48 36 2 69 1 Erp44 Endoplasmic reticulum resident protein 44 Mus musculus
Q6ES52 1.21e-06 48 29 1 71 2 Os09g0401200 TPR repeat-containing thioredoxin TDX Oryza sativa subsp. japonica
D3Z6P0 1.25e-06 48 30 0 78 1 Pdia2 Protein disulfide-isomerase A2 Mus musculus
D3Z6P0 8.38e-06 46 30 1 71 1 Pdia2 Protein disulfide-isomerase A2 Mus musculus
Q13087 1.35e-06 48 32 1 71 1 PDIA2 Protein disulfide-isomerase A2 Homo sapiens
Q13087 2.51e-06 47 36 2 75 1 PDIA2 Protein disulfide-isomerase A2 Homo sapiens
Q8GXV2 1.49e-06 47 31 3 76 2 CXXS2 Thioredoxin-like protein CXXS2 Arabidopsis thaliana
Q5WGY8 1.52e-06 47 21 3 125 3 resA Probable thiol-disulfide oxidoreductase ResA Shouchella clausii (strain KSM-K16)
Q9ZPH2 1.58e-06 48 25 1 76 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q8LDI5 1.96e-06 46 29 1 74 2 CXXS1 Thioredoxin-like protein CXXS1 Arabidopsis thaliana
Q8JGM4 1.99e-06 48 33 2 87 1 QSOX1 Sulfhydryl oxidase 1 Gallus gallus
Q8LEK4 2.18e-06 47 26 2 86 1 At4g26160 Thioredoxin-like 2-1, chloroplastic Arabidopsis thaliana
Q6A555 2.5e-06 46 30 2 73 1 TXNDC8 Thioredoxin domain-containing protein 8 Homo sapiens
Q9JLZ1 2.61e-06 47 31 2 73 1 Glrx3 Glutaredoxin-3 Rattus norvegicus
Q9CQM9 2.82e-06 47 31 2 73 1 Glrx3 Glutaredoxin-3 Mus musculus
Q9CAS1 3.09e-06 46 28 1 66 2 TRX8 Thioredoxin H8 Arabidopsis thaliana
Q69ST6 4.56e-06 47 27 1 74 2 PDIL1-3 Protein disulfide isomerase-like 1-3 Oryza sativa subsp. japonica
Q69ST6 0.000653 40 30 2 73 2 PDIL1-3 Protein disulfide isomerase-like 1-3 Oryza sativa subsp. japonica
Q57755 6.1e-06 44 29 0 57 1 trx Thioredoxin Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A0A8M1N5Y4 6.36e-06 46 32 1 62 2 tmx3a Protein disulfide-isomerase tmx3a Danio rerio
Q9BS26 8.1e-06 46 33 2 69 1 ERP44 Endoplasmic reticulum resident protein 44 Homo sapiens
Q655X0 1.2e-05 45 29 3 86 2 Os06g0665900 Thioredoxin O, mitochondrial Oryza sativa subsp. japonica
Q7XRB5 1.25e-05 45 30 3 95 2 PDIL1-2 Protein disulfide isomerase-like 1-2 Oryza sativa subsp. japonica
Q86H62 1.34e-05 45 26 2 90 3 glrx3 Glutaredoxin-3 homolog Dictyostelium discoideum
Q67IX6 1.97e-05 45 29 2 94 2 PDIL1-4 Protein disulfide isomerase-like 1-4 Oryza sativa subsp. japonica
Q6IUU3 2.38e-05 45 29 2 87 1 Qsox1 Sulfhydryl oxidase 1 Rattus norvegicus
Q28ID3 2.6e-05 44 30 2 73 2 glrx3 Glutaredoxin-3 Xenopus tropicalis
Q81SZ9 4.04e-05 43 26 4 124 1 resA Thiol-disulfide oxidoreductase ResA Bacillus anthracis
A0RBT0 4.04e-05 43 26 4 124 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis (strain Al Hakam)
Q8ZD52 4.47e-05 43 33 2 75 3 dsbE Thiol:disulfide interchange protein DsbE Yersinia pestis
Q81FU5 4.47e-05 43 26 4 124 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8VZT6 4.5e-05 43 28 3 89 2 WCRKC2 Thioredoxin-like 3-2, chloroplastic Arabidopsis thaliana
P30960 5.1e-05 43 23 3 102 1 cycY Thiol:disulfide interchange protein CycY Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P35088 6.56e-05 43 26 3 87 3 txlA Thiol:disulfide interchange protein TxlA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P43787 7.58e-05 42 23 2 114 3 HI_1115 Thioredoxin-like protein HI_1115 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A4IQF5 7.82e-05 42 27 3 107 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus thermodenitrificans (strain NG80-2)
Q0Z7W6 8.32e-05 43 25 2 88 2 TMX1 Thioredoxin-related transmembrane protein 1 Bos taurus
Q6P902 8.53e-05 43 33 2 72 1 Txndc2 Thioredoxin domain-containing protein 2 Mus musculus
O26898 8.79e-05 41 29 2 81 1 MTH_807 Probable Thioredoxin Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q54NX2 8.99e-05 42 24 1 99 3 DDB_G0284941 Thioredoxin domain-containing protein, mitochondrial Dictyostelium discoideum
Q9H3N1 9.2e-05 43 26 2 87 1 TMX1 Thioredoxin-related transmembrane protein 1 Homo sapiens
Q00002 0.000108 43 36 2 60 1 None Protein disulfide-isomerase (Fragment) Alternaria alternata
Q0IWL9 0.00011 43 26 1 69 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q4VWQ3 0.000131 42 25 1 62 1 TRX3 Thioredoxin 3 Plasmodium falciparum (isolate 3D7)
P45409 0.000155 42 28 3 101 3 cycY Thiol:disulfide interchange protein CycY Rhizobium leguminosarum bv. viciae
Q86XW9 0.000296 41 26 0 91 1 NME9 Thioredoxin domain-containing protein 6 Homo sapiens
Q7JW12 0.000302 41 27 3 101 2 CG11007 Thioredoxin-related transmembrane protein 2 homolog Drosophila melanogaster
Q39592 0.000303 41 28 1 84 1 None Dynein 16 kDa light chain, flagellar outer arm Chlamydomonas reinhardtii
Q5HVG7 0.000317 41 24 2 94 3 dsbD Thiol:disulfide interchange protein DsbD Campylobacter jejuni (strain RM1221)
Q9PHR3 0.000317 41 24 2 94 3 dsbD Thiol:disulfide interchange protein DsbD Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9SA00 0.000322 41 31 1 66 2 APRL4 5'-adenylylsulfate reductase-like 4 Arabidopsis thaliana
Q63DQ8 0.000337 41 25 4 126 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ZK / E33L)
O08841 0.000362 41 28 2 87 1 QSOX1 Sulfhydryl oxidase 1 Cavia porcellus
P87178 0.000371 41 25 4 108 1 SPBC3D6.13c Uncharacterized protein C3D6.13c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q73B22 0.000377 40 27 4 111 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q66GQ3 0.000378 41 22 0 81 2 PDIL1-6 Protein disulfide isomerase-like 1-6 Arabidopsis thaliana
Q6IRC5 0.000415 41 27 0 100 2 nme9 Thioredoxin domain-containing protein 6 Xenopus laevis
Q8BND5 0.000426 41 27 2 87 1 Qsox1 Sulfhydryl oxidase 1 Mus musculus
P64808 0.000447 41 25 1 104 3 BQ2027_MB1359 Uncharacterized protein Mb1359 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WG61 0.000447 41 25 1 104 1 Rv1324 Uncharacterized protein Rv1324 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG60 0.000447 41 25 1 104 3 MT1366 Uncharacterized protein MT1366 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6HL81 0.000457 40 27 4 111 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis subsp. konkukian (strain 97-27)
A3KPF5 0.000464 41 28 1 87 2 PDIL1-5 Protein disulfide isomerase-like 1-5 Arabidopsis thaliana
Q8LCT3 0.000592 40 28 4 88 2 At4g29670 Thioredoxin-like 2-2, chloroplastic Arabidopsis thaliana
Q5KXL9 0.000598 40 27 3 88 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus kaustophilus (strain HTA426)
P32474 0.000643 40 30 3 92 1 EUG1 Protein disulfide-isomerase EUG1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5TKD8 0.000656 40 25 2 101 2 Os05g0200100 Thioredoxin-like 2, chloroplastic Oryza sativa subsp. japonica
Q8CXF3 0.000675 40 32 2 62 3 resA Thiol-disulfide oxidoreductase ResA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P52236 0.000698 40 40 1 42 3 ccmG Thiol:disulfide interchange protein DsbE homolog Paracoccus denitrificans (strain Pd 1222)
P42035 0.000735 38 29 2 81 1 MTBMA_c12030 Probable Thioredoxin Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
O31687 0.000796 40 25 4 109 1 stoA Sporulation thiol-disulfide oxidoreductase A Bacillus subtilis (strain 168)
Q10N04 0.000819 39 22 1 106 2 PDIL5-1 Protein disulfide isomerase-like 5-1 Oryza sativa subsp. japonica
P44943 0.000872 40 30 4 100 3 nrfX Probable thiol:disulfide interchange protein DsbE-2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q5XJ54 0.000877 40 32 2 71 2 glrx3 Glutaredoxin 3 Danio rerio

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_12900
Feature type CDS
Gene trxA
Product thioredoxin TrxA
Location 18200 - 18526 (strand: 1)
Length 327 (nucleotides) / 108 (amino acids)

Contig

Accession ZDB_370
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1326
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00085 Thioredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3118 Posttranslational modification, protein turnover, chaperones (O) O Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family

Kegg Ortholog Annotation(s)

Protein Sequence

MSDKIIHLTDSVFEQSVLKANGPVLVDFWAAWCGPCKMIAPILDEIADEYAGKITIAKLNIDDNPQTAPQYGIRGIPTLLLFKDGVVKATQVGAVSKTQLKTFIDNNI

Flanking regions ( +/- flanking 50bp)

TTAAATAATGGTAGACTAACCGAGTATCGTACAAATTTTGGAGTGGAACAATGAGCGATAAAATTATTCACCTGACTGATTCCGTTTTCGAACAAAGCGTATTAAAAGCAAACGGCCCTGTGCTCGTTGATTTTTGGGCAGCCTGGTGTGGCCCGTGTAAAATGATTGCCCCTATTCTAGACGAAATCGCCGACGAATATGCAGGGAAAATCACTATCGCAAAACTGAACATTGATGATAACCCGCAGACAGCGCCGCAATACGGCATTCGCGGTATCCCGACATTACTGCTGTTCAAAGACGGCGTGGTGAAGGCAACGCAGGTTGGTGCGGTATCCAAAACCCAGCTGAAAACCTTTATCGATAACAATATCTGATAGCCGGTTTCAGCATATGTCGTTAAGATGTCCTGCGGGAACGTGAATTA