Homologs in group_1383

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08210 FBDBKF_08210 94.4 Morganella morganii S1 trxA thioredoxin TrxA
EHELCC_13315 EHELCC_13315 94.4 Morganella morganii S2 trxA thioredoxin TrxA
NLDBIP_13655 NLDBIP_13655 94.4 Morganella morganii S4 trxA thioredoxin TrxA
LHKJJB_12900 LHKJJB_12900 94.4 Morganella morganii S3 trxA thioredoxin TrxA
HKOGLL_12130 HKOGLL_12130 94.4 Morganella morganii S5 trxA thioredoxin TrxA
PMI_RS16470 PMI_RS16470 75.9 Proteus mirabilis HI4320 trxA thioredoxin TrxA

Distribution of the homologs in the orthogroup group_1383

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1383

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AA30 2.19e-57 175 75 0 108 3 trxA Thioredoxin 1 Shigella flexneri
P0AA28 2.19e-57 175 75 0 108 1 trxA Thioredoxin 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA29 2.19e-57 175 75 0 108 1 trxA Thioredoxin 1 Salmonella typhi
P0AA25 2.19e-57 175 75 0 108 1 trxA Thioredoxin 1 Escherichia coli (strain K12)
P0AA26 2.19e-57 175 75 0 108 3 trxA Thioredoxin 1 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA27 2.19e-57 175 75 0 108 1 trxA Thioredoxin 1 Escherichia coli O157:H7
Q9X2T1 4.15e-54 167 67 0 108 3 trxA Thioredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52233 7.61e-51 159 64 0 108 3 trxA Thioredoxin Acidithiobacillus ferridurans
P09857 9.92e-50 155 63 0 106 1 trxA Thioredoxin Allochromatium vinosum
P57653 6.04e-45 144 60 0 106 3 trxA Thioredoxin Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P43785 1.21e-44 143 58 0 105 3 trxA Thioredoxin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O51890 4.2e-44 142 63 0 106 3 trxA Thioredoxin Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P96132 7.61e-43 138 67 0 91 3 trxA Thioredoxin (Fragment) Thiocapsa roseopersicina
P59527 2.1e-42 137 57 0 105 3 trxA Thioredoxin Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9CM49 1.52e-41 135 56 0 105 3 trxA Thioredoxin Pasteurella multocida (strain Pm70)
P12243 8.36e-40 130 54 0 101 3 trxA Thioredoxin 1 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P10473 1.28e-39 130 53 0 102 1 trxA Thioredoxin Rhodospirillum rubrum
P00275 1.69e-39 130 56 0 99 1 None Thioredoxin C-1 Corynebacterium nephridii
P0A4L2 1.9e-39 130 55 0 102 1 trxA Thioredoxin 1 Nostoc sp. (strain ATCC 29151 / PCC 7119)
P0A4L1 1.9e-39 130 55 0 102 3 trxA Thioredoxin 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P07887 2.52e-39 129 54 0 108 1 None Thioredoxin C-2 Corynebacterium nephridii
P33791 9.13e-39 128 53 0 103 3 trxA Thioredoxin (Fragment) Kitasatospora aureofaciens
P48384 6.09e-38 128 56 0 101 1 None Thioredoxin M-type, chloroplastic Pisum sativum
P52231 9.48e-38 125 52 0 102 1 trxA Thioredoxin Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q92JR5 1.42e-37 125 52 0 102 3 trxA Thioredoxin Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q4UNK3 1.53e-37 125 52 0 102 3 trxA Thioredoxin Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q1RKN1 2.24e-37 124 51 0 102 3 trxA Thioredoxin Rickettsia bellii (strain RML369-C)
P50254 2.54e-37 124 52 0 102 3 trxA Thioredoxin Neopyropia yezoensis
Q41864 4.62e-37 125 51 0 106 2 TRM1 Thioredoxin M-type, chloroplastic Zea mays
Q9ZEE0 7.08e-37 123 51 0 102 1 trxA Thioredoxin Rickettsia prowazekii (strain Madrid E)
Q9ZP21 9.27e-37 125 51 0 106 2 None Thioredoxin M-type, chloroplastic Triticum aestivum
P51225 1.22e-36 122 51 0 102 3 trxA Thioredoxin Porphyra purpurea
Q9XGS0 1.93e-36 124 56 0 102 1 None Thioredoxin M-type, chloroplastic Brassica napus
Q9ZP20 4.09e-36 123 54 0 97 2 TRXM Thioredoxin M5, chloroplastic Oryza sativa subsp. japonica
Q9SEU8 8.29e-36 123 54 0 99 1 TRXM2 Thioredoxin M2, chloroplastic Arabidopsis thaliana
P52230 9.03e-36 120 58 0 100 1 trxA Thioredoxin 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q7M1B9 1.05e-35 120 54 0 103 1 trxA Thioredoxin Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
P37395 1.09e-35 120 54 0 95 3 trxA Thioredoxin Cyanidium caldarium
P07591 1.74e-35 122 54 0 98 1 None Thioredoxin M-type, chloroplastic Spinacia oleracea
Q68Y00 2.3e-35 119 50 0 102 3 trxA Thioredoxin Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P08058 2.59e-35 119 50 0 99 1 trxA Thioredoxin Cereibacter sphaeroides
O48737 9.72e-35 120 55 0 98 1 At1g03680 Thioredoxin M1, chloroplastic Arabidopsis thaliana
Q8KE49 1.34e-34 117 49 0 108 3 trx2 Thioredoxin 2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P80579 1.63e-33 115 54 1 94 1 trxA Thioredoxin Alicyclobacillus acidocaldarius subsp. acidocaldarius
P10472 6.12e-33 113 47 0 105 1 trxA Thioredoxin Chlorobaculum thiosulfatiphilum
Q6H7E4 1.31e-32 114 46 0 107 2 Os02g0639900 Thioredoxin M1, chloroplastic Oryza sativa subsp. japonica
P9WG67 1.94e-32 112 54 0 95 1 trxA Thioredoxin Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG66 1.94e-32 112 54 0 95 3 trxA Thioredoxin Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A617 1.94e-32 112 54 0 95 3 trxA Thioredoxin Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P23400 3.92e-32 112 51 0 93 1 TRXM Thioredoxin M-type, chloroplastic Chlamydomonas reinhardtii
Q9SEU6 1.26e-31 112 45 0 103 2 At3g15360 Thioredoxin M4, chloroplastic Arabidopsis thaliana
P50338 2.68e-31 109 51 0 96 3 trxA Thioredoxin Griffithsia pacifica
Q7X8R5 6.53e-31 110 43 0 107 2 Os04g0530600 Thioredoxin M2, chloroplastic Oryza sativa subsp. japonica
Q05739 4.21e-30 106 53 1 100 1 trxA Thioredoxin Streptomyces clavuligerus
P0A0K5 4.5e-30 106 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain MW2)
P0A0K6 4.5e-30 106 48 1 104 1 trxA Thioredoxin Staphylococcus aureus
Q6GA69 4.5e-30 106 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain MSSA476)
Q6GHU0 4.5e-30 106 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain MRSA252)
P99122 4.5e-30 106 48 1 104 1 trxA Thioredoxin Staphylococcus aureus (strain N315)
P0A0K4 4.5e-30 106 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGT9 4.5e-30 106 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain COL)
Q2YXD0 4.5e-30 106 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZD2 4.5e-30 106 48 1 104 2 trxA Thioredoxin Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHT6 4.5e-30 106 48 1 104 3 trxA Thioredoxin Staphylococcus aureus (strain USA300)
O22022 4.85e-30 106 51 1 96 3 trxA Thioredoxin Cyanidioschyzon merolae (strain NIES-3377 / 10D)
Q8CPL5 6.39e-30 105 48 1 104 3 trxA Thioredoxin Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQ29 6.39e-30 105 48 1 104 3 trxA Thioredoxin Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P66928 1.04e-29 105 51 1 96 1 trxA Thioredoxin Helicobacter pylori (strain ATCC 700392 / 26695)
P66929 1.04e-29 105 51 1 96 3 trxA Thioredoxin Helicobacter pylori (strain J99 / ATCC 700824)
Q4L5F0 1.43e-29 105 47 1 104 3 trxA Thioredoxin Staphylococcus haemolyticus (strain JCSC1435)
P14949 2.56e-29 104 46 1 104 1 trxA Thioredoxin Bacillus subtilis (strain 168)
P20857 2.57e-29 104 41 0 108 1 trxB Thioredoxin 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q49WR2 5.88e-29 103 47 1 104 3 trxA Thioredoxin Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P0A4L3 6.96e-29 103 45 1 102 3 trxA Thioredoxin Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4L4 6.96e-29 103 45 1 102 3 trxA Thioredoxin Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
O30974 1.52e-28 102 49 1 97 1 trxA Thioredoxin Mycolicibacterium smegmatis
Q7XQQ2 3.42e-28 103 46 0 101 2 Os04g0430800 Thioredoxin M3, chloroplastic Oryza sativa subsp. japonica
P46843 5.16e-27 105 49 0 95 3 trxB/A Bifunctional thioredoxin reductase/thioredoxin Mycobacterium leprae (strain TN)
Q7XKD0 2.05e-26 99 43 1 103 2 TRX-X Thioredoxin X, chloroplastic Oryza sativa subsp. japonica
P73263 4e-25 94 42 0 92 1 slr1139 Thioredoxin-like protein slr1139 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8LD49 4.46e-25 95 40 1 104 2 ATHX Thioredoxin X, chloroplastic Arabidopsis thaliana
Q8KEA4 1.15e-24 92 38 0 91 3 trx1 Thioredoxin 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P0AGG7 4.35e-24 92 37 1 105 3 trxC Thioredoxin 2 Shigella flexneri
P0AGG4 4.35e-24 92 37 1 105 1 trxC Thioredoxin 2 Escherichia coli (strain K12)
P0AGG5 4.35e-24 92 37 1 105 3 trxC Thioredoxin 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGG6 4.35e-24 92 37 1 105 3 trxC Thioredoxin 2 Escherichia coli O157:H7
P52227 6.56e-24 90 48 1 88 3 trxA Thioredoxin Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q9SEU7 8.24e-24 92 42 0 95 2 GAT1 Thioredoxin M3, chloroplastic Arabidopsis thaliana
Q9Z7P5 3.16e-23 89 44 2 100 3 trxA Thioredoxin Chlamydia pneumoniae
Q9PJK3 3.2e-23 89 48 1 88 3 trxA Thioredoxin Chlamydia muridarum (strain MoPn / Nigg)
O83889 3.25e-23 89 44 0 84 3 trxA Thioredoxin Treponema pallidum (strain Nichols)
O84544 1.11e-22 87 46 1 88 3 trxA Thioredoxin Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q6NPF9 1.79e-22 89 40 0 97 1 At1g76760 Thioredoxin Y1, chloroplastic Arabidopsis thaliana
Q8L7S9 5.21e-22 87 40 0 100 2 At1g43560 Thioredoxin Y2, chloroplastic Arabidopsis thaliana
Q8IFW4 1.98e-21 85 42 0 83 1 TrxT Thioredoxin-T Drosophila melanogaster
P52232 7.1e-21 83 43 0 76 1 slr0233 Thioredoxin-like protein slr0233 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q5JMR9 1.52e-20 84 39 0 100 3 Os01g0963400 Thioredoxin Y, chloroplastic Oryza sativa subsp. japonica
Q9R6P9 3.08e-20 81 34 1 98 3 trxA Thioredoxin Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q1RQI9 7.22e-20 80 43 2 87 1 None Thioredoxin (Fragment) Malassezia sympodialis
Q95108 2.87e-19 80 37 0 96 1 TXN2 Thioredoxin, mitochondrial Bos taurus
P47370 6.22e-19 77 37 2 97 3 trxA Thioredoxin Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P97493 6.93e-19 79 38 0 92 1 Txn2 Thioredoxin, mitochondrial Mus musculus
Q99757 7.39e-19 79 38 0 92 1 TXN2 Thioredoxin, mitochondrial Homo sapiens
P97615 7.63e-19 79 38 0 92 2 Txn2 Thioredoxin, mitochondrial Rattus norvegicus
Q17424 1.12e-18 78 36 0 94 3 trx-2 Probable thioredoxin-2 Caenorhabditis elegans
P29429 1.89e-18 77 41 1 86 1 TRX1 Thioredoxin Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q6XHI1 7e-18 75 38 2 91 3 Trx2 Thioredoxin-2 Drosophila yakuba
G4NFB7 2.07e-17 75 37 2 103 1 TRX2 Thioredoxin-2 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q9V429 3.28e-17 73 37 2 91 1 Trx2 Thioredoxin-2 Drosophila melanogaster
P34723 6.36e-17 72 39 1 84 1 TRXA Thioredoxin Penicillium chrysogenum
Q1RQJ0 7.36e-17 72 36 3 97 1 CDV57_00134 Thioredoxin Asp f 29 Aspergillus fumigatus
P42115 1.09e-16 72 36 1 87 3 trx Thioredoxin Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q1RQJ1 1.15e-16 72 41 1 68 1 None Thioredoxin Asp f 28 Aspergillus fumigatus
P22217 2.22e-16 71 46 1 71 1 TRX1 Thioredoxin-1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P52228 4.38e-16 72 35 2 91 3 None Thioredoxin C-3 Corynebacterium nephridii
P80028 4.45e-16 70 41 1 85 1 TRXH Thioredoxin H-type Chlamydomonas reinhardtii
Q8TFM8 6.59e-16 70 36 1 95 1 None Thioredoxin-like protein Fusarium culmorum
Q9UW02 1.27e-15 69 34 2 86 1 None Thioredoxin Coprinus comatus
Q0E0I1 1.5e-15 73 41 2 86 3 PDIL5-3 Protein disulfide isomerase-like 5-3 Oryza sativa subsp. japonica
P21609 1.81e-15 69 38 1 88 1 trxA Thioredoxin Peptoclostridium litorale
P22803 2.4e-15 68 37 2 85 1 TRX2 Thioredoxin-2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O48773 3.85e-15 72 34 0 102 2 PDIL2-3 Protein disulfide-isomerase 2-3 Arabidopsis thaliana
O48773 8.11e-11 60 31 1 99 2 PDIL2-3 Protein disulfide-isomerase 2-3 Arabidopsis thaliana
O17486 4.08e-15 68 32 2 105 3 TRX Thioredoxin Echinococcus granulosus
Q8JG64 4.14e-15 72 35 0 92 2 PDIA3 Protein disulfide-isomerase A3 Gallus gallus
Q8JG64 8.5e-07 48 30 2 82 2 PDIA3 Protein disulfide-isomerase A3 Gallus gallus
A2YIW7 4.25e-15 68 39 1 71 1 TRXH Thioredoxin H-type Oryza sativa subsp. indica
Q0D840 4.25e-15 68 39 1 71 1 TRXH Thioredoxin H1 Oryza sativa subsp. japonica
P81109 5.09e-15 68 36 0 82 1 trxA Thioredoxin Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / CCUG 9281 / NCIMB 10654 / HF)
Q9V438 7.42e-15 72 38 0 88 1 CaBP1 Protein disulfide-isomerase A6 homolog Drosophila melanogaster
Q9V438 1.34e-12 65 34 0 81 1 CaBP1 Protein disulfide-isomerase A6 homolog Drosophila melanogaster
Q39362 9.09e-15 67 36 0 71 2 THL-2 Thioredoxin H-type 2 Brassica napus
P75512 1.23e-14 67 34 2 91 3 trxA Thioredoxin Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
O64394 1.38e-14 67 37 2 79 2 None Thioredoxin H-type Triticum aestivum
Q0JD42 1.38e-14 71 44 2 85 2 PDIL5-2 Protein disulfide isomerase-like 5-2 Oryza sativa subsp. japonica
P21610 2.43e-14 66 36 0 85 1 trxA Thioredoxin Peptoclostridium acidaminophilum
Q9MAU6 2.87e-14 70 32 0 102 2 PDIL2-2 Protein disulfide-isomerase like 2-2 Arabidopsis thaliana
Q9MAU6 1.48e-11 62 32 2 101 2 PDIL2-2 Protein disulfide-isomerase like 2-2 Arabidopsis thaliana
C9K7C5 4.07e-14 66 41 2 82 2 AMT13 Thioredoxin AMT13 Alternaria alternata
Q9RD25 4.45e-14 66 34 2 99 2 trxC Putative thioredoxin 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q75M08 5.99e-14 69 39 1 84 2 PDIL2-1 Protein disulfide isomerase-like 2-1 Oryza sativa subsp. japonica
Q75M08 2.19e-11 62 34 2 88 2 PDIL2-1 Protein disulfide isomerase-like 2-1 Oryza sativa subsp. japonica
Q00216 6.34e-14 69 35 1 85 2 tigA Protein disulfide-isomerase tigA Aspergillus niger
Q00216 1.25e-07 51 32 4 106 2 tigA Protein disulfide-isomerase tigA Aspergillus niger
P29445 7.64e-14 65 33 6 110 1 trxA Thioredoxin-1 Dictyostelium discoideum
Q39239 8.15e-14 65 35 0 71 1 TRX4 Thioredoxin H4 Arabidopsis thaliana
Q09433 8.72e-14 65 34 2 87 1 trx-1 Thioredoxin-1 Caenorhabditis elegans
P38657 9.51e-14 68 37 1 83 2 PDIA3 Protein disulfide-isomerase A3 Bos taurus
P38657 1.07e-06 48 34 2 70 2 PDIA3 Protein disulfide-isomerase A3 Bos taurus
Q7KQL8 1.04e-13 64 37 2 82 1 TRX1 Thioredoxin 1 Plasmodium falciparum (isolate 3D7)
Q92249 1.15e-13 68 42 2 78 2 erp38 Protein disulfide-isomerase erp38 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q92249 4.03e-09 55 36 3 87 2 erp38 Protein disulfide-isomerase erp38 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
O96952 1.18e-13 64 34 3 101 3 THIO Thioredoxin Geodia cydonium
P50413 1.33e-13 64 33 3 96 3 TXN Thioredoxin Ovis aries
Q4VIT4 1.39e-13 68 38 1 83 1 PDIA3 Protein disulfide-isomerase A3 Chlorocebus aethiops
Q4VIT4 4.56e-07 49 34 2 70 1 PDIA3 Protein disulfide-isomerase A3 Chlorocebus aethiops
P77395 1.6e-13 67 34 1 85 1 cnoX Chaperedoxin Escherichia coli (strain K12)
P27773 1.7e-13 68 38 1 83 1 Pdia3 Protein disulfide-isomerase A3 Mus musculus
P27773 2.84e-06 47 30 3 95 1 Pdia3 Protein disulfide-isomerase A3 Mus musculus
P11598 1.72e-13 68 38 1 83 1 Pdia3 Protein disulfide-isomerase A3 Rattus norvegicus
P11598 1.52e-06 48 31 3 95 1 Pdia3 Protein disulfide-isomerase A3 Rattus norvegicus
O14463 1.81e-13 63 34 1 88 3 trx1 Thioredoxin-1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q43636 1.97e-13 64 34 2 87 3 None Thioredoxin H-type Ricinus communis
Q5RDG4 2.11e-13 67 37 1 83 2 PDIA3 Protein disulfide-isomerase A3 Pongo abelii
Q5RDG4 4.56e-07 49 34 2 70 2 PDIA3 Protein disulfide-isomerase A3 Pongo abelii
P30101 2.11e-13 67 37 1 83 1 PDIA3 Protein disulfide-isomerase A3 Homo sapiens
P30101 4.56e-07 49 34 2 70 1 PDIA3 Protein disulfide-isomerase A3 Homo sapiens
Q869Z0 2.67e-13 67 35 0 78 1 DDB_G0275025 Putative protein disulfide-isomerase DDB_G0275025 Dictyostelium discoideum
Q11067 2.75e-13 67 38 0 84 3 pdi-6 Protein disulfide-isomerase A6 homolog Caenorhabditis elegans
Q11067 2.7e-08 53 27 0 80 3 pdi-6 Protein disulfide-isomerase A6 homolog Caenorhabditis elegans
Q67UF5 2.94e-13 67 35 0 90 2 PDIL2-3 Protein disulfide isomerase-like 2-3 Oryza sativa subsp. japonica
Q67UF5 1.31e-09 57 32 0 77 2 PDIL2-3 Protein disulfide isomerase-like 2-3 Oryza sativa subsp. japonica
Q4N4N8 2.94e-13 65 28 1 105 1 TP02_0602 Thioredoxin domain-containing protein Theileria parva
Q9BDJ3 3.29e-13 63 33 3 96 3 TXN Thioredoxin Callithrix jacchus
Q5R6T1 3.47e-13 67 33 2 111 2 PDIA6 Protein disulfide-isomerase A6 Pongo abelii
Q5R6T1 4.37e-10 58 32 0 81 2 PDIA6 Protein disulfide-isomerase A6 Pongo abelii
Q15084 3.47e-13 67 33 2 111 1 PDIA6 Protein disulfide-isomerase A6 Homo sapiens
Q15084 4.41e-10 58 32 0 81 1 PDIA6 Protein disulfide-isomerase A6 Homo sapiens
Q9USR1 3.85e-13 66 39 1 66 4 txl1 Thioredoxin-like protein 1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P82460 4.61e-13 63 33 3 96 1 TXN Thioredoxin Sus scrofa
O51088 4.87e-13 63 30 2 88 3 trxA Thioredoxin Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
O97680 5.19e-13 62 33 3 96 3 TXN Thioredoxin Bos taurus
P10599 5.66e-13 62 35 3 94 1 TXN Thioredoxin Homo sapiens
P25372 6.11e-13 63 32 1 90 1 TRX3 Thioredoxin-3, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P38661 7.19e-13 66 34 1 92 2 None Probable protein disulfide-isomerase A6 Medicago sativa
P38661 1.45e-10 59 31 3 101 2 None Probable protein disulfide-isomerase A6 Medicago sativa
O97508 7.33e-13 62 32 4 98 3 TXN Thioredoxin Equus caballus
P38660 7.95e-13 66 32 2 111 1 PDIA6 Protein disulfide-isomerase A6 Mesocricetus auratus
P38660 1.65e-10 59 32 0 81 1 PDIA6 Protein disulfide-isomerase A6 Mesocricetus auratus
P29447 8.42e-13 62 32 5 107 3 trxC Thioredoxin-3 Dictyostelium discoideum
P29451 8.72e-13 62 33 2 83 3 TXN Thioredoxin Macaca mulatta
Q942L2 9.72e-13 65 33 3 106 2 PDIL2-2 Protein disulfide isomerase-like 2-2 Oryza sativa subsp. japonica
Q942L2 4.2e-12 63 35 1 84 2 PDIL2-2 Protein disulfide isomerase-like 2-2 Oryza sativa subsp. japonica
Q91W90 1.07e-12 65 33 3 103 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
Q91W90 3.62e-08 52 32 2 83 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
Q91W90 7.83e-06 46 30 1 65 1 Txndc5 Thioredoxin domain-containing protein 5 Mus musculus
Q9LKW0 1.09e-12 63 35 2 88 1 CITRX Thioredoxin-like protein CITRX, chloroplastic Solanum lycopersicum
P47938 1.16e-12 62 29 0 71 1 dhd Thioredoxin-1 Drosophila melanogaster
P08629 1.58e-12 61 33 3 89 3 TXN Thioredoxin Gallus gallus
A2YUQ6 2.18e-12 63 32 3 107 3 OsI_29059 Thioredoxin-like protein CITRX, chloroplastic Oryza sativa subsp. indica
P08628 2.33e-12 61 32 4 100 1 TXN Thioredoxin Oryctolagus cuniculus
Q8H2V6 2.34e-12 63 32 3 107 2 Os08g0378900 Thioredoxin-like protein CITRX, chloroplastic Oryza sativa subsp. japonica
Q42403 3.25e-12 61 31 1 74 1 TRX3 Thioredoxin H3 Arabidopsis thaliana
M1A3D5 3.51e-12 62 36 1 86 3 CITRX Thioredoxin-like protein CITRX, chloroplastic Solanum tuberosum
Q43116 3.57e-12 64 36 3 99 2 None Protein disulfide-isomerase Ricinus communis
Q43116 4.26e-06 47 31 2 67 2 None Protein disulfide-isomerase Ricinus communis
P29828 3.65e-12 64 36 3 99 2 PDI Protein disulfide-isomerase Medicago sativa
P29828 6.06e-06 46 27 3 86 2 PDI Protein disulfide-isomerase Medicago sativa
O64764 3.98e-12 62 38 3 85 1 At2g35010 Thioredoxin O1, mitochondrial Arabidopsis thaliana
Q5R9M3 4.66e-12 60 32 2 94 3 TXN Thioredoxin Pongo abelii
Q63081 4.68e-12 63 30 2 111 1 Pdia6 Protein disulfide-isomerase A6 Rattus norvegicus
Q63081 4.23e-11 61 33 0 81 1 Pdia6 Protein disulfide-isomerase A6 Rattus norvegicus
Q922R8 5.26e-12 63 30 2 111 1 Pdia6 Protein disulfide-isomerase A6 Mus musculus
Q922R8 8e-12 63 34 0 81 1 Pdia6 Protein disulfide-isomerase A6 Mus musculus
Q38879 5.42e-12 60 35 1 71 1 TRX2 Thioredoxin H2 Arabidopsis thaliana
Q9M7X9 6.79e-12 62 36 2 88 1 CITRX Thioredoxin-like protein CITRX, chloroplastic Arabidopsis thaliana
O22263 7.02e-12 63 38 2 83 2 PDIL2-1 Protein disulfide-isomerase like 2-1 Arabidopsis thaliana
O22263 3.09e-11 61 35 1 80 2 PDIL2-1 Protein disulfide-isomerase like 2-1 Arabidopsis thaliana
P29449 7.73e-12 60 33 1 83 2 None Thioredoxin H-type 1 Nicotiana tabacum
Q498R3 9.22e-12 63 36 0 77 2 Dnajc10 DnaJ homolog subfamily C member 10 Rattus norvegicus
Q498R3 7.36e-07 49 30 1 84 2 Dnajc10 DnaJ homolog subfamily C member 10 Rattus norvegicus
Q498R3 4.12e-05 44 29 0 79 2 Dnajc10 DnaJ homolog subfamily C member 10 Rattus norvegicus
Q498R3 0.000129 42 24 1 89 2 Dnajc10 DnaJ homolog subfamily C member 10 Rattus norvegicus
P60226 9.32e-12 59 29 0 71 2 dhd Thioredoxin-1 Drosophila yakuba
Q9XF61 9.37e-12 63 36 3 99 2 PDI Protein disulfide-isomerase Datisca glomerata
Q9XF61 3.22e-05 44 27 3 86 2 PDI Protein disulfide-isomerase Datisca glomerata
O94504 1.06e-11 60 37 1 74 1 trx2 Thioredoxin-2, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q96419 1.12e-11 59 32 1 71 3 None Thioredoxin H-type Fagopyrum esculentum
Q86IA3 1.21e-11 62 37 3 89 1 pdi1 Protein disulfide-isomerase 1 Dictyostelium discoideum
Q86IA3 1.9e-11 62 32 3 108 1 pdi1 Protein disulfide-isomerase 1 Dictyostelium discoideum
P09856 1.24e-11 61 40 3 81 1 None Thioredoxin F-type, chloroplastic Spinacia oleracea
P10639 1.24e-11 59 29 2 101 1 Txn Thioredoxin Mus musculus
Q9DC23 1.44e-11 62 35 0 78 1 Dnajc10 DnaJ homolog subfamily C member 10 Mus musculus
Q9DC23 1.12e-06 48 29 1 84 1 Dnajc10 DnaJ homolog subfamily C member 10 Mus musculus
Q9DC23 2.46e-05 45 26 1 89 1 Dnajc10 DnaJ homolog subfamily C member 10 Mus musculus
Q9DC23 6.69e-05 43 29 0 79 1 Dnajc10 DnaJ homolog subfamily C member 10 Mus musculus
P11232 1.54e-11 59 29 2 101 1 Txn Thioredoxin Rattus norvegicus
Q54EN4 1.73e-11 62 40 1 74 3 pdi2 Protein disulfide-isomerase 2 Dictyostelium discoideum
Q54EN4 1.88e-09 56 33 1 81 3 pdi2 Protein disulfide-isomerase 2 Dictyostelium discoideum
Q07090 2.28e-11 58 34 2 85 3 None Thioredoxin H-type 2 Nicotiana tabacum
Q9TW67 2.78e-11 62 39 1 61 1 png-1 Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase Caenorhabditis elegans
Q851R5 2.79e-11 59 31 2 92 2 Os03g0800700 Thioredoxin H2-2 Oryza sativa subsp. japonica
Q17967 3.33e-11 61 37 2 87 3 pdi-1 Protein disulfide-isomerase 1 Caenorhabditis elegans
Q17967 1.6e-09 57 34 0 79 3 pdi-1 Protein disulfide-isomerase 1 Caenorhabditis elegans
P29448 3.39e-11 58 32 2 85 1 TRX1 Thioredoxin H1 Arabidopsis thaliana
Q39241 3.4e-11 58 30 1 71 1 TRX5 Thioredoxin H5 Arabidopsis thaliana
Q10057 3.44e-11 61 31 3 109 3 SPAC1F5.02 Putative protein disulfide-isomerase C1F5.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q10057 7.38e-08 52 36 1 63 3 SPAC1F5.02 Putative protein disulfide-isomerase C1F5.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5WNE3 3.58e-11 61 35 2 84 3 png-1 Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase Caenorhabditis briggsae
P96611 3.87e-11 58 34 2 90 2 ydbP Thioredoxin-like protein YdbP Bacillus subtilis (strain 168)
Q6JE37 4.02e-11 59 34 1 86 1 CITRX2 Thioredoxin-like protein CITRX2, chloroplastic Nicotiana benthamiana
Q6JE38 5.69e-11 59 34 1 86 2 CITRX1 Thioredoxin-like protein CITRX1, chloroplastic Nicotiana benthamiana
O65049 9.21e-11 57 35 1 71 2 SB09 Thioredoxin H-type Picea mariana
Q9DGI3 9.26e-11 57 28 4 107 3 txn Thioredoxin Ictalurus punctatus
Q98TX1 9.76e-11 57 30 2 81 3 TXN Thioredoxin Ophiophagus hannah
Q5R5L3 9.89e-11 60 34 0 83 2 DNAJC10 DnaJ homolog subfamily C member 10 Pongo abelii
Q5R5L3 3.92e-06 47 26 1 93 2 DNAJC10 DnaJ homolog subfamily C member 10 Pongo abelii
Q5R5L3 9.58e-06 46 28 1 84 2 DNAJC10 DnaJ homolog subfamily C member 10 Pongo abelii
Q5R5L3 0.000154 42 27 0 79 2 DNAJC10 DnaJ homolog subfamily C member 10 Pongo abelii
Q8NBS9 1.01e-10 60 30 3 103 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
Q8NBS9 1.69e-08 53 29 2 106 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
Q8NBS9 3.54e-06 47 32 1 65 1 TXNDC5 Thioredoxin domain-containing protein 5 Homo sapiens
Q9XI01 1.09e-10 60 31 1 98 1 PDIL1-1 Protein disulfide isomerase-like 1-1 Arabidopsis thaliana
Q9XI01 1.96e-07 50 32 3 73 1 PDIL1-1 Protein disulfide isomerase-like 1-1 Arabidopsis thaliana
Q9VYV3 1.1e-10 60 29 2 107 1 prtp Thioredoxin domain-containing protein 5 homolog Drosophila melanogaster
Q9VYV3 1.84e-07 50 26 3 100 1 prtp Thioredoxin domain-containing protein 5 homolog Drosophila melanogaster
Q9VYV3 1.18e-06 48 34 1 75 1 prtp Thioredoxin domain-containing protein 5 homolog Drosophila melanogaster
Q70G58 1.21e-10 60 30 0 84 1 Os07g0657900 Thioredoxin reductase NTRC Oryza sativa subsp. japonica
Q50KB1 1.25e-10 58 29 2 107 1 SEP2 Protein disulfide-isomerase-like protein EhSep2 Emiliania huxleyi
P54399 1.33e-10 60 36 0 76 2 Pdi Protein disulfide-isomerase Drosophila melanogaster
P54399 1.09e-09 57 39 2 81 2 Pdi Protein disulfide-isomerase Drosophila melanogaster
P09102 1.53e-10 59 34 2 90 1 P4HB Protein disulfide-isomerase Gallus gallus
P09102 2.69e-09 56 34 0 79 1 P4HB Protein disulfide-isomerase Gallus gallus
Q6Z4I3 1.63e-10 57 32 2 82 2 Os07g0190800 Thioredoxin H2-1 Oryza sativa subsp. japonica
Q17770 2.29e-10 59 35 0 81 1 pdi-2 Protein disulfide-isomerase 2 Caenorhabditis elegans
Q17770 1.2e-09 57 33 2 87 1 pdi-2 Protein disulfide-isomerase 2 Caenorhabditis elegans
P09103 2.61e-10 58 33 2 92 1 P4hb Protein disulfide-isomerase Mus musculus
P09103 4.22e-08 52 32 0 75 1 P4hb Protein disulfide-isomerase Mus musculus
Q5UR25 2.72e-10 58 28 3 111 1 MIMI_R362 Thioredoxin domain-containing protein R362 Acanthamoeba polyphaga mimivirus
Q8S091 2.72e-10 57 37 3 81 2 Os01g0913000 Thioredoxin F, chloroplastic Oryza sativa subsp. japonica
O48897 2.76e-10 57 37 3 83 2 TRXF Thioredoxin F-type, chloroplastic Brassica napus
Q8IXB1 2.8e-10 58 34 0 75 1 DNAJC10 DnaJ homolog subfamily C member 10 Homo sapiens
Q8IXB1 9.58e-06 46 28 1 84 1 DNAJC10 DnaJ homolog subfamily C member 10 Homo sapiens
Q8IXB1 1.37e-05 45 26 1 91 1 DNAJC10 DnaJ homolog subfamily C member 10 Homo sapiens
Q8IXB1 0.000154 42 27 0 79 1 DNAJC10 DnaJ homolog subfamily C member 10 Homo sapiens
P04785 3.17e-10 58 34 2 87 1 P4hb Protein disulfide-isomerase Rattus norvegicus
P04785 1.08e-08 54 32 0 75 1 P4hb Protein disulfide-isomerase Rattus norvegicus
Q93VQ9 3.25e-10 57 31 4 109 1 At1g31020 Thioredoxin O2, mitochondrial Arabidopsis thaliana
P08003 3.44e-10 58 30 2 101 1 Pdia4 Protein disulfide-isomerase A4 Mus musculus
P08003 2.9e-08 53 32 2 83 1 Pdia4 Protein disulfide-isomerase A4 Mus musculus
P08003 5.74e-06 46 30 2 81 1 Pdia4 Protein disulfide-isomerase A4 Mus musculus
Q9XFH9 3.51e-10 57 39 3 81 1 At5g16400 Thioredoxin F2, chloroplastic Arabidopsis thaliana
A0A509AQW5 3.57e-10 57 28 2 111 1 TRX2 Thioredoxin 2 Plasmodium berghei (strain Anka)
Q8VX13 3.9e-10 58 30 1 97 2 PDIL1-3 Protein disulfide isomerase-like 1-3 Arabidopsis thaliana
Q8VX13 4.86e-07 49 26 0 79 2 PDIL1-3 Protein disulfide isomerase-like 1-3 Arabidopsis thaliana
P29450 4.37e-10 57 36 2 72 2 None Thioredoxin F-type, chloroplastic Pisum sativum
P21195 5.36e-10 58 33 2 92 2 P4HB Protein disulfide-isomerase Oryctolagus cuniculus
P21195 2.45e-08 53 32 0 78 2 P4HB Protein disulfide-isomerase Oryctolagus cuniculus
P29446 5.46e-10 54 28 2 83 2 trxB Thioredoxin-2 (Fragment) Dictyostelium discoideum
O22229 5.7e-10 58 26 0 101 1 NTRC NADPH-dependent thioredoxin reductase 3 Arabidopsis thaliana
Q1ZXE0 5.95e-10 55 29 3 87 3 trxD Putative thioredoxin-4 Dictyostelium discoideum
Q9SRG3 7.17e-10 57 29 1 98 2 PDIL1-2 Protein disulfide isomerase-like 1-2 Arabidopsis thaliana
Q9SRG3 5.34e-06 46 29 3 86 2 PDIL1-2 Protein disulfide isomerase-like 1-2 Arabidopsis thaliana
D4B2L8 8.57e-10 57 33 5 108 3 ARB_02626 Protein disulfide-isomerase Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
D4B2L8 3.35e-08 53 37 1 61 3 ARB_02626 Protein disulfide-isomerase Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371)
Q12730 8.64e-10 57 34 3 104 2 pdiA Protein disulfide-isomerase Aspergillus niger
Q12730 4.61e-08 52 35 2 80 2 pdiA Protein disulfide-isomerase Aspergillus niger
P07237 9.69e-10 57 32 2 92 1 P4HB Protein disulfide-isomerase Homo sapiens
P07237 8.33e-08 52 32 0 75 1 P4HB Protein disulfide-isomerase Homo sapiens
P52589 9.99e-10 57 31 1 93 2 PDI Protein disulfide-isomerase Triticum aestivum
P52589 1.82e-07 50 35 2 67 2 PDI Protein disulfide-isomerase Triticum aestivum
P05307 1.04e-09 57 32 2 92 1 P4HB Protein disulfide-isomerase Bos taurus
P05307 4.18e-08 52 32 0 75 1 P4HB Protein disulfide-isomerase Bos taurus
Q5R5B6 1.05e-09 57 32 2 92 2 P4HB Protein disulfide-isomerase Pongo abelii
Q5R5B6 8.66e-08 52 32 0 75 2 P4HB Protein disulfide-isomerase Pongo abelii
Q2HWU2 1.05e-09 57 32 2 92 2 P4HB Protein disulfide-isomerase Macaca fuscata fuscata
Q2HWU2 3.54e-08 53 32 0 75 2 P4HB Protein disulfide-isomerase Macaca fuscata fuscata
P12865 1.14e-09 57 29 1 103 3 BS2 Bloodstream-specific protein 2 Trypanosoma brucei brucei
P12865 1.79e-05 45 26 1 86 3 BS2 Bloodstream-specific protein 2 Trypanosoma brucei brucei
Q8R4U2 1.27e-09 57 32 2 92 2 P4HB Protein disulfide-isomerase Cricetulus griseus
Q8R4U2 6.41e-08 52 32 0 75 2 P4HB Protein disulfide-isomerase Cricetulus griseus
Q9XFH8 1.33e-09 55 38 3 83 1 At3g02730 Thioredoxin F1, chloroplastic Arabidopsis thaliana
Q9AS75 1.43e-09 54 35 1 71 2 Os01g0168200 Thioredoxin H4-1 Oryza sativa subsp. japonica
P73920 1.55e-09 55 36 3 75 3 txlA Thiol:disulfide interchange protein TxlA homolog Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8IDP4 1.6e-09 55 25 0 85 1 TRX2 Thioredoxin 2 Plasmodium falciparum (isolate 3D7)
P13667 1.68e-09 56 30 1 79 1 PDIA4 Protein disulfide-isomerase A4 Homo sapiens
P13667 1.44e-07 51 33 2 81 1 PDIA4 Protein disulfide-isomerase A4 Homo sapiens
P13667 3.74e-06 47 30 2 84 1 PDIA4 Protein disulfide-isomerase A4 Homo sapiens
Q12404 2.21e-09 56 32 1 81 1 MPD1 Protein disulfide-isomerase MPD1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q7Y0D4 2.89e-09 55 31 3 87 2 Os03g0767500 Thioredoxin-like protein HCF164, chloroplastic Oryza sativa subsp. japonica
Q94F09 3.08e-09 55 38 2 84 1 PDIL5-2 Protein disulfide-isomerase 5-2 Arabidopsis thaliana
Q29RV1 3.87e-09 55 30 1 79 2 PDIA4 Protein disulfide-isomerase A4 Bos taurus
Q29RV1 1.43e-06 48 30 2 84 2 PDIA4 Protein disulfide-isomerase A4 Bos taurus
Q29RV1 5.26e-06 47 32 2 81 2 PDIA4 Protein disulfide-isomerase A4 Bos taurus
P34329 3.94e-09 55 36 3 87 3 C14B9.2 Probable protein disulfide-isomerase A4 Caenorhabditis elegans
P34329 2.98e-07 50 27 2 86 3 C14B9.2 Probable protein disulfide-isomerase A4 Caenorhabditis elegans
P34329 0.000524 41 29 3 74 3 C14B9.2 Probable protein disulfide-isomerase A4 Caenorhabditis elegans
Q69AB2 3.96e-09 53 36 1 60 1 Txndc8 Thioredoxin domain-containing protein 8 Mus musculus
O81332 4.11e-09 54 36 2 75 2 None Thioredoxin F-type, chloroplastic Mesembryanthemum crystallinum
P38658 5.13e-09 55 32 2 87 3 None Probable protein disulfide-isomerase ER-60 Schistosoma mansoni
P38658 5.11e-05 43 28 1 85 3 None Probable protein disulfide-isomerase ER-60 Schistosoma mansoni
O23166 5.51e-09 55 30 2 81 1 HCF164 Thioredoxin-like protein HCF164, chloroplastic Arabidopsis thaliana
Q69AB1 5.63e-09 53 33 1 62 2 Txndc8 Thioredoxin domain-containing protein 8 Rattus norvegicus
Q9FF55 6.14e-09 55 33 1 83 1 PDIL1-4 Protein disulfide isomerase-like 1-4 Arabidopsis thaliana
Q9FF55 1.1e-06 48 26 0 75 1 PDIL1-4 Protein disulfide isomerase-like 1-4 Arabidopsis thaliana
Q00248 6.72e-09 55 33 2 98 3 pdiA Protein disulfide-isomerase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
Q00248 6.8e-08 52 35 2 80 3 pdiA Protein disulfide-isomerase Aspergillus oryzae (strain ATCC 42149 / RIB 40)
P38659 6.88e-09 55 28 2 101 1 Pdia4 Protein disulfide-isomerase A4 Rattus norvegicus
P38659 8.78e-08 52 33 2 81 1 Pdia4 Protein disulfide-isomerase A4 Rattus norvegicus
P38659 6.27e-06 46 30 2 81 1 Pdia4 Protein disulfide-isomerase A4 Rattus norvegicus
P80284 7.19e-09 55 30 1 93 1 PDI Protein disulfide-isomerase Hordeum vulgare
P80284 3.13e-07 50 35 2 67 1 PDI Protein disulfide-isomerase Hordeum vulgare
P85801 8.6e-09 52 35 1 71 1 None Thioredoxin H-type Populus jackii
Q14554 1.14e-08 54 35 2 92 1 PDIA5 Protein disulfide-isomerase A5 Homo sapiens
Q14554 2.65e-08 53 28 2 84 1 PDIA5 Protein disulfide-isomerase A5 Homo sapiens
O64432 1.3e-08 52 29 2 79 2 PEC-2 Thioredoxin H-type Brassica campestris
D3Z6P0 1.36e-08 54 31 1 96 1 Pdia2 Protein disulfide-isomerase A2 Mus musculus
D3Z6P0 1.72e-05 45 29 1 74 1 Pdia2 Protein disulfide-isomerase A2 Mus musculus
P68176 1.39e-08 52 29 2 79 2 BOPC17 Thioredoxin H-type Brassica oleracea
P68177 1.39e-08 52 29 2 79 2 THL-1 Thioredoxin H-type 1 Brassica napus
P68570 1.41e-08 52 28 2 97 3 bdbA Disulfide bond formation protein A Bacillus phage SPbeta
P68569 1.41e-08 52 28 2 97 3 bdbA SPbeta prophage-derived disulfide bond formation protein A Bacillus subtilis (strain 168)
O13811 1.56e-08 53 30 2 97 3 SPAC17H9.14c Protein disulfide-isomerase C17H9.14c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O13811 5.82e-06 46 26 1 84 3 SPAC17H9.14c Protein disulfide-isomerase C17H9.14c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5I0H9 1.57e-08 53 37 3 91 2 Pdia5 Protein disulfide-isomerase A5 Rattus norvegicus
Q5I0H9 8.18e-08 52 28 2 84 2 Pdia5 Protein disulfide-isomerase A5 Rattus norvegicus
Q2KIL5 1.81e-08 53 28 2 84 2 PDIA5 Protein disulfide-isomerase A5 Bos taurus
Q2KIL5 4.49e-07 49 35 2 85 2 PDIA5 Protein disulfide-isomerase A5 Bos taurus
O13704 1.89e-08 53 35 2 78 4 SPAC13F5.05 Thioredoxin domain-containing protein C13F5.05, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q921X9 2.55e-08 53 35 2 89 1 Pdia5 Protein disulfide-isomerase A5 Mus musculus
Q921X9 2.65e-08 53 28 2 84 1 Pdia5 Protein disulfide-isomerase A5 Mus musculus
Q9C9Y6 2.58e-08 51 30 1 71 1 TRX9 Thioredoxin H9 Arabidopsis thaliana
Q13087 2.68e-08 53 33 0 78 1 PDIA2 Protein disulfide-isomerase A2 Homo sapiens
Q13087 1.06e-06 48 32 1 74 1 PDIA2 Protein disulfide-isomerase A2 Homo sapiens
Q0DKF1 2.79e-08 51 35 1 71 2 Os05g0169000 Thioredoxin H4-2 Oryza sativa subsp. japonica
Q5R875 3.08e-08 53 32 2 82 2 TMX3 Protein disulfide-isomerase TMX3 Pongo abelii
P55059 3.47e-08 53 32 2 80 1 None Protein disulfide-isomerase Humicola insolens
P55059 2.92e-07 50 31 4 103 1 None Protein disulfide-isomerase Humicola insolens
Q5RCH2 3.48e-08 53 31 3 106 2 PDIA2 Protein disulfide-isomerase A2 Pongo abelii
Q5RCH2 1.29e-07 51 32 1 74 2 PDIA2 Protein disulfide-isomerase A2 Pongo abelii
Q9LXZ8 3.82e-08 51 32 2 80 3 At3g56420 Putative thioredoxin H10 Arabidopsis thaliana
Q8BXZ1 3.96e-08 52 37 1 62 1 Tmx3 Protein disulfide-isomerase TMX3 Mus musculus
O76003 4.35e-08 52 34 2 73 1 GLRX3 Glutaredoxin-3 Homo sapiens
Q58DA7 4.38e-08 52 31 2 77 2 GLRX3 Glutaredoxin-3 Bos taurus
Q96JJ7 4.67e-08 52 37 1 62 1 TMX3 Protein disulfide-isomerase TMX3 Homo sapiens
P81110 4.86e-08 48 50 0 44 1 trxA Thioredoxin (Fragment) Tissierella creatinophila
Q5UR29 5.35e-08 50 34 3 94 3 MIMI_R548 Thioredoxin-like protein R548 Acanthamoeba polyphaga mimivirus
Q6NRT6 6.3e-08 52 33 1 87 2 dnajc10 DnaJ homolog subfamily C member 10 Xenopus laevis
Q6NRT6 4.41e-06 47 28 1 80 2 dnajc10 DnaJ homolog subfamily C member 10 Xenopus laevis
Q6NRT6 2.68e-05 44 30 0 79 2 dnajc10 DnaJ homolog subfamily C member 10 Xenopus laevis
Q6NRT6 0.000296 42 30 0 63 2 dnajc10 DnaJ homolog subfamily C member 10 Xenopus laevis
Q75GM1 6.45e-08 50 29 2 85 2 Os05g0480200 Thioredoxin H5 Oryza sativa subsp. japonica
Q53LQ0 8.83e-08 52 37 1 67 2 PDIL1-1 Protein disulfide isomerase-like 1-1 Oryza sativa subsp. japonica
Q53LQ0 1.87e-07 50 32 3 85 2 PDIL1-1 Protein disulfide isomerase-like 1-1 Oryza sativa subsp. japonica
Q6ES52 1.31e-07 51 29 2 94 2 Os09g0401200 TPR repeat-containing thioredoxin TDX Oryza sativa subsp. japonica
Q9FG36 1.55e-07 50 28 1 74 2 WCRKC1 Thioredoxin-like 3-1, chloroplastic Arabidopsis thaliana
Q8VWG7 2.11e-07 50 29 1 71 1 TDX TPR repeat-containing thioredoxin TDX Arabidopsis thaliana
O31820 2.99e-07 49 23 2 107 3 yneN Thioredoxin-like protein YneN Bacillus subtilis (strain 168)
Q8JGM4 3.03e-07 50 34 2 93 1 QSOX1 Sulfhydryl oxidase 1 Gallus gallus
P17967 3.16e-07 50 32 2 84 1 PDI1 Protein disulfide-isomerase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P17967 5.95e-07 49 35 5 119 1 PDI1 Protein disulfide-isomerase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9JLZ1 3.22e-07 50 32 2 73 1 Glrx3 Glutaredoxin-3 Rattus norvegicus
P52588 3.48e-07 50 36 1 65 2 PDI Protein disulfide-isomerase Zea mays
P52588 1.12e-05 45 32 3 85 2 PDI Protein disulfide-isomerase Zea mays
Q9CQM9 3.55e-07 50 32 2 73 1 Glrx3 Glutaredoxin-3 Mus musculus
Q9XIF4 3.62e-07 48 33 2 78 2 TRX7 Thioredoxin H7 Arabidopsis thaliana
Q54NX2 3.78e-07 48 26 1 99 3 DDB_G0284941 Thioredoxin domain-containing protein, mitochondrial Dictyostelium discoideum
Q6Z7L3 4.16e-07 49 34 2 72 3 Os02g0774100 Thioredoxin-like 3-1, chloroplastic Oryza sativa subsp. japonica
Q3T0L2 7.34e-07 49 31 3 91 2 ERP44 Endoplasmic reticulum resident protein 44 Bos taurus
Q8LEK4 8.14e-07 48 26 2 86 1 At4g26160 Thioredoxin-like 2-1, chloroplastic Arabidopsis thaliana
Q8LCH9 9.1e-07 47 26 2 78 2 At3g53220 Thioredoxin-like 3-3 Arabidopsis thaliana
Q6GNG3 1.12e-06 48 35 1 62 2 tmx3 Protein disulfide-isomerase TMX3 Xenopus laevis
Q9ZPH2 1.29e-06 48 25 1 76 1 GRXS17 Monothiol glutaredoxin-S17 Arabidopsis thaliana
Q54KN7 1.29e-06 46 28 3 97 3 trxE Putative thioredoxin-5 Dictyostelium discoideum
Q8LDI5 1.57e-06 46 29 1 72 2 CXXS1 Thioredoxin-like protein CXXS1 Arabidopsis thaliana
Q69ST6 1.74e-06 48 26 1 75 2 PDIL1-3 Protein disulfide isomerase-like 1-3 Oryza sativa subsp. japonica
Q9D1Q6 1.8e-06 48 34 2 82 1 Erp44 Endoplasmic reticulum resident protein 44 Mus musculus
Q9CAS1 2.14e-06 46 32 2 70 2 TRX8 Thioredoxin H8 Arabidopsis thaliana
Q8GXV2 2.28e-06 46 30 2 86 2 CXXS2 Thioredoxin-like protein CXXS2 Arabidopsis thaliana
Q28ID3 2.83e-06 47 31 2 73 2 glrx3 Glutaredoxin-3 Xenopus tropicalis
Q8VZT6 3.62e-06 46 25 4 106 2 WCRKC2 Thioredoxin-like 3-2, chloroplastic Arabidopsis thaliana
Q7XRB5 3.63e-06 47 26 1 97 2 PDIL1-2 Protein disulfide isomerase-like 1-2 Oryza sativa subsp. japonica
Q7XRB5 0.000788 40 25 3 90 2 PDIL1-2 Protein disulfide isomerase-like 1-2 Oryza sativa subsp. japonica
Q5WGY8 5.27e-06 46 22 3 125 3 resA Probable thiol-disulfide oxidoreductase ResA Shouchella clausii (strain KSM-K16)
Q0Z7W6 6.75e-06 46 24 3 101 2 TMX1 Thioredoxin-related transmembrane protein 1 Bos taurus
Q655X0 7.71e-06 45 29 3 86 2 Os06g0665900 Thioredoxin O, mitochondrial Oryza sativa subsp. japonica
Q9H3N1 8.32e-06 46 26 3 100 1 TMX1 Thioredoxin-related transmembrane protein 1 Homo sapiens
Q57755 8.59e-06 43 30 2 73 1 trx Thioredoxin Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P35088 1e-05 45 25 3 87 3 txlA Thiol:disulfide interchange protein TxlA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q6DFS0 1.01e-05 45 25 5 117 2 tmx2 Thioredoxin-related transmembrane protein 2 Xenopus tropicalis
A0A8M1N5Y4 1.17e-05 45 32 1 62 2 tmx3a Protein disulfide-isomerase tmx3a Danio rerio
Q6A555 1.3e-05 44 27 2 80 1 TXNDC8 Thioredoxin domain-containing protein 8 Homo sapiens
Q9BS26 1.6e-05 45 32 2 75 1 ERP44 Endoplasmic reticulum resident protein 44 Homo sapiens
A4IQF5 1.86e-05 44 25 3 107 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus thermodenitrificans (strain NG80-2)
Q58E26 2.01e-05 45 25 5 117 2 tmx2 Thioredoxin-related transmembrane protein 2 Xenopus laevis
Q81SZ9 2.26e-05 44 27 4 111 1 resA Thiol-disulfide oxidoreductase ResA Bacillus anthracis
A0RBT0 2.26e-05 44 27 4 111 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis (strain Al Hakam)
Q81FU5 2.48e-05 44 27 4 111 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5HVG7 2.58e-05 44 27 3 99 3 dsbD Thiol:disulfide interchange protein DsbD Campylobacter jejuni (strain RM1221)
Q9PHR3 2.58e-05 44 27 3 99 3 dsbD Thiol:disulfide interchange protein DsbD Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q86H62 2.6e-05 44 25 2 90 3 glrx3 Glutaredoxin-3 homolog Dictyostelium discoideum
P30960 2.67e-05 44 23 3 102 1 cycY Thiol:disulfide interchange protein CycY Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P45409 3.06e-05 43 28 3 101 3 cycY Thiol:disulfide interchange protein CycY Rhizobium leguminosarum bv. viciae
Q67IX6 4.71e-05 44 24 0 74 2 PDIL1-4 Protein disulfide isomerase-like 1-4 Oryza sativa subsp. japonica
Q67IX6 0.000359 41 28 2 88 2 PDIL1-4 Protein disulfide isomerase-like 1-4 Oryza sativa subsp. japonica
Q66GQ3 4.73e-05 43 22 0 81 2 PDIL1-6 Protein disulfide isomerase-like 1-6 Arabidopsis thaliana
P87178 4.97e-05 43 25 4 108 1 SPBC3D6.13c Uncharacterized protein C3D6.13c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q0IWL9 5.12e-05 43 26 1 69 2 GRXS11 Monothiol glutaredoxin-S11 Oryza sativa subsp. japonica
Q6P902 7.02e-05 43 31 4 92 1 Txndc2 Thioredoxin domain-containing protein 2 Mus musculus
Q8BND5 7.56e-05 43 29 3 107 1 Qsox1 Sulfhydryl oxidase 1 Mus musculus
Q8ZD52 7.78e-05 43 33 2 75 3 dsbE Thiol:disulfide interchange protein DsbE Yersinia pestis
Q8LCT3 8.05e-05 43 26 2 86 2 At4g29670 Thioredoxin-like 2-2, chloroplastic Arabidopsis thaliana
Q6IUU3 8.91e-05 43 28 2 94 1 Qsox1 Sulfhydryl oxidase 1 Rattus norvegicus
Q5TKD8 0.0001 42 26 2 101 2 Os05g0200100 Thioredoxin-like 2, chloroplastic Oryza sativa subsp. japonica
Q8N807 0.000124 42 30 0 83 1 PDILT Protein disulfide-isomerase-like protein of the testis Homo sapiens
Q86XW9 0.000184 42 24 0 100 1 NME9 Thioredoxin domain-containing protein 6 Homo sapiens
Q73B22 0.000191 41 26 3 105 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q63DQ8 0.000214 41 26 4 113 3 resA Thiol-disulfide oxidoreductase ResA Bacillus cereus (strain ZK / E33L)
P32474 0.000215 42 29 2 86 1 EUG1 Protein disulfide-isomerase EUG1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q6HL81 0.000218 41 26 3 105 3 resA Thiol-disulfide oxidoreductase ResA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6AX23 0.000249 42 27 1 94 2 qsox2 Sulfhydryl oxidase 2 Xenopus laevis
Q0J9V5 0.00025 40 27 2 83 2 Os04g0629500 Thioredoxin-like protein CXXS1 Oryza sativa subsp. japonica
Q7JW12 0.000279 41 27 2 98 2 CG11007 Thioredoxin-related transmembrane protein 2 homolog Drosophila melanogaster
Q00002 0.000295 42 34 2 61 1 None Protein disulfide-isomerase (Fragment) Alternaria alternata
P64808 0.000309 41 24 1 104 3 BQ2027_MB1359 Uncharacterized protein Mb1359 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WG61 0.000309 41 24 1 104 1 Rv1324 Uncharacterized protein Rv1324 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG60 0.000309 41 24 1 104 3 MT1366 Uncharacterized protein MT1366 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O26898 0.000311 39 28 2 81 1 MTH_807 Probable Thioredoxin Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q5KXL9 0.000361 40 23 3 107 3 resA Thiol-disulfide oxidoreductase ResA Geobacillus kaustophilus (strain HTA426)
Q39592 0.000368 40 27 2 90 1 None Dynein 16 kDa light chain, flagellar outer arm Chlamydomonas reinhardtii
O08841 0.000423 41 27 2 94 1 QSOX1 Sulfhydryl oxidase 1 Cavia porcellus
Q8CXF3 0.000505 40 23 3 127 3 resA Thiol-disulfide oxidoreductase ResA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6IRC5 0.000578 40 27 0 100 2 nme9 Thioredoxin domain-containing protein 6 Xenopus laevis
P43787 0.000702 40 25 3 115 3 HI_1115 Thioredoxin-like protein HI_1115 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O74790 0.000754 40 25 2 85 1 grx4 Monothiol glutaredoxin-4 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O34342 0.001 38 25 1 60 3 yosR SPbeta prophage-derived thioredoxin-like protein YosR Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18760
Feature type CDS
Gene trxA
Product thioredoxin TrxA
Location 20636 - 20962 (strand: 1)
Length 327 (nucleotides) / 108 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000010
Length 36620 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1383
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00085 Thioredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3118 Posttranslational modification, protein turnover, chaperones (O) O Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family

Kegg Ortholog Annotation(s)

Protein Sequence

MSDKIIHLTDSSFEQLVLKATGPVLVDFWAAWCGPCKMIAPILDEIAEEYAGKITITKLNIDDNPQTAPQYGIRGIPTLLLFKDGSVKATQVGAVSKTQLKTFIDNNI

Flanking regions ( +/- flanking 50bp)

TTAGTTAGTGTTAAACTAATGGGGTATTGTATAAATCTTGGAGCTGAACAATGAGCGATAAAATTATTCACCTGACTGATTCCAGTTTTGAACAACTCGTGTTAAAAGCAACCGGCCCTGTACTCGTTGACTTTTGGGCGGCATGGTGTGGTCCTTGTAAAATGATTGCCCCTATTCTAGACGAAATCGCCGAAGAATATGCAGGGAAAATTACCATCACTAAACTGAACATCGATGATAACCCGCAGACCGCGCCTCAATACGGCATCCGTGGTATTCCCACACTGCTGCTGTTTAAAGATGGCAGCGTGAAAGCGACCCAGGTTGGTGCAGTGTCTAAGACACAACTGAAAACGTTCATCGATAATAATATCTGATTGTTCATTTTAGTGCATATTATTAAGACGTCCGGGGGCGACAACAAATT