Homologs in group_926

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05030 FBDBKF_05030 100.0 Morganella morganii S1 rsxB electron transport complex subunit RsxB
EHELCC_12560 EHELCC_12560 100.0 Morganella morganii S2 rsxB electron transport complex subunit RsxB
NLDBIP_12900 NLDBIP_12900 100.0 Morganella morganii S4 rsxB electron transport complex subunit RsxB
HKOGLL_11375 HKOGLL_11375 100.0 Morganella morganii S5 rsxB electron transport complex subunit RsxB
F4V73_RS05470 F4V73_RS05470 92.1 Morganella psychrotolerans rsxB electron transport complex subunit RsxB
PMI_RS06295 PMI_RS06295 75.7 Proteus mirabilis HI4320 rsxB electron transport complex subunit RsxB

Distribution of the homologs in the orthogroup group_926

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_926

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q1CIY8 1.78e-105 304 75 1 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8U7 1.78e-105 304 75 1 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis bv. Antiqua (strain Angola)
Q8ZEC9 1.78e-105 304 75 1 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis
Q1C7K2 1.78e-105 304 75 1 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis bv. Antiqua (strain Antiqua)
B7NB82 9.65e-103 297 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q0THJ9 1.19e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3Z1Y3 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella sonnei (strain Ss046)
Q1RBG8 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain UTI89 / UPEC)
B1LEQ8 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain SMS-3-5 / SECEC)
B6IB63 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain SE11)
A1ABH3 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O1:K1 / APEC
B7NU05 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z462 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58323 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O157:H7
B7L5I1 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain 55989 / EAEC)
B7M9Y2 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZM88 1.37e-101 294 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LQP2 2.01e-101 293 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8AH09 2.17e-101 293 74 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7URW9 2.7e-101 293 74 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P77223 3.43e-101 293 73 1 189 1 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain K12)
B1IQC6 3.43e-101 293 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0H1 3.43e-101 293 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O9:H4 (strain HS)
B1XF93 3.43e-101 293 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain K12 / DH10B)
C4ZY91 3.43e-101 293 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0I5 3.43e-101 293 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O8 (strain IAI1)
B7MV10 6.48e-101 292 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O81 (strain ED1a)
Q83KY6 6.92e-101 292 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella flexneri
Q320Y5 6.92e-101 292 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella boydii serotype 4 (strain Sb227)
Q8FH96 1.03e-100 292 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B2U2C7 1.21e-100 291 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q32FE5 1.38e-100 291 73 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella dysenteriae serotype 1 (strain Sd197)
B2VEQ2 1.17e-98 286 73 2 190 3 rnfB Ion-translocating oxidoreductase complex subunit B Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q8Z6R0 5.18e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella typhi
B4TV18 5.18e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella schwarzengrund (strain CVM19633)
B5BKB1 5.18e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi A (strain AKU_12601)
C0Q507 5.18e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi C (strain RKS4594)
Q5PIC0 5.18e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RAK1 5.18e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV01 5.18e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella enteritidis PT4 (strain P125109)
Q57PH9 5.18e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella choleraesuis (strain SC-B67)
B5F6I9 5.18e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella agona (strain SL483)
Q8ZPM1 7.85e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N024 7.85e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4THD5 7.85e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella heidelberg (strain SL476)
B5FIE6 7.85e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella dublin (strain CT_02021853)
B4T595 7.94e-98 285 72 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella newport (strain SL254)
A9MRW7 2.22e-97 283 71 1 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8GE01 3.21e-96 280 75 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Serratia proteamaculans (strain 568)
B6EGH6 5.33e-95 277 69 1 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Aliivibrio salmonicida (strain LFI1238)
B5XWQ0 8.56e-93 272 73 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Klebsiella pneumoniae (strain 342)
C6DH16 1.37e-92 271 73 1 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4W3 5.63e-92 270 72 1 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NSZ6 5.92e-91 267 67 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Sodalis glossinidius (strain morsitans)
Q7MM82 1.86e-89 263 66 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio vulnificus (strain YJ016)
Q8D889 1.86e-89 263 66 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio vulnificus (strain CMCP6)
A7MMM3 5.34e-89 262 71 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Cronobacter sakazakii (strain ATCC BAA-894)
B5FCN4 3.59e-88 260 70 1 171 3 rnfB Ion-translocating oxidoreductase complex subunit B Aliivibrio fischeri (strain MJ11)
Q5E6B7 3.59e-88 260 70 1 171 3 rnfB Ion-translocating oxidoreductase complex subunit B Aliivibrio fischeri (strain ATCC 700601 / ES114)
A8H537 6.7e-86 254 59 1 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CM57 7.72e-86 254 60 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella piezotolerans (strain WP3 / JCM 13877)
B7VLT8 1.97e-85 253 69 1 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio atlanticus (strain LGP32)
C3LTR4 5.88e-85 252 69 1 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio cholerae serotype O1 (strain M66-2)
Q9KT87 5.88e-85 252 69 1 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2R3 5.88e-85 252 69 1 168 1 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C5BDE6 8.69e-85 251 65 0 183 3 rnfB Ion-translocating oxidoreductase complex subunit B Edwardsiella ictaluri (strain 93-146)
A4SNP6 1.04e-84 251 69 2 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Aeromonas salmonicida (strain A449)
A0KLJ3 3.15e-84 250 69 2 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A7MVC6 3.51e-84 250 69 1 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio campbellii (strain ATCC BAA-1116)
C4LEP6 1.77e-83 248 60 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q87MX3 4.02e-83 248 69 1 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A0KX80 2.49e-82 245 61 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sp. (strain ANA-3)
Q0HVF6 4.17e-82 245 61 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sp. (strain MR-7)
Q8EE80 6.12e-82 244 60 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HIH9 9.27e-82 244 60 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sp. (strain MR-4)
A8FUX9 1.04e-78 236 62 1 170 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sediminis (strain HAW-EB3)
P71396 9.48e-78 234 60 3 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UBJ1 9.48e-78 234 60 3 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus influenzae (strain PittEE)
Q4QJQ7 9.48e-78 234 60 3 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus influenzae (strain 86-028NP)
Q7VNT5 1.22e-77 234 59 2 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A3QEN5 9e-77 231 63 1 166 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1S6N0 1.05e-74 226 57 1 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q9CNP1 1.16e-74 226 55 3 201 3 rnfB Ion-translocating oxidoreductase complex subunit B Pasteurella multocida (strain Pm70)
Q2SKU5 4.92e-73 222 60 1 184 3 rnfB Ion-translocating oxidoreductase complex subunit B Hahella chejuensis (strain KCTC 2396)
Q3SHB7 1.39e-71 218 55 3 190 3 rnfB Ion-translocating oxidoreductase complex subunit B Thiobacillus denitrificans (strain ATCC 25259)
A4XS52 8.03e-70 214 59 1 173 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas mendocina (strain ymp)
A6V1T8 6.77e-69 211 56 2 175 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain PA7)
A1K5F2 1.66e-68 210 55 2 179 3 rnfB Ion-translocating oxidoreductase complex subunit B Azoarcus sp. (strain BH72)
Q9HYB9 2.04e-68 210 56 2 175 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UWJ3 2.04e-68 210 56 2 175 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain LESB58)
Q02QX9 4.15e-68 209 56 2 175 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain UCBPP-PA14)
Q5P1B1 8.45e-68 208 56 2 179 3 rnfB Ion-translocating oxidoreductase complex subunit B Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q0VP40 1.28e-67 208 60 0 158 3 rnfB Ion-translocating oxidoreductase complex subunit B Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A4VIV5 6.16e-66 204 57 1 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Stutzerimonas stutzeri (strain A1501)
A0L5G7 1.54e-58 184 52 3 176 3 rnfB Ion-translocating oxidoreductase complex subunit B Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q0AAG8 1.15e-53 172 56 1 155 3 rnfB Ion-translocating oxidoreductase complex subunit B Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B8D719 1.41e-45 151 40 1 160 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57214 5.27e-45 150 40 1 160 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8R5 5.27e-45 150 40 1 160 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q8KA20 3.76e-44 147 41 3 163 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q3IXC5 3.93e-41 140 47 3 156 3 rnfB Ion-translocating oxidoreductase complex subunit B Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PRP4 1.54e-40 139 46 3 156 3 rnfB Ion-translocating oxidoreductase complex subunit B Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
D5ARZ0 1.81e-39 136 45 2 151 3 rnfB Ion-translocating oxidoreductase complex subunit B Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0CZ14 1.81e-39 136 45 2 151 1 rnfB Ion-translocating oxidoreductase complex subunit B Rhodobacter capsulatus
Q89AW9 6.36e-35 124 41 3 147 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
D8GR71 5.84e-27 106 30 3 192 3 rnfB Proton-translocating ferredoxin:NAD(+) oxidoreductase complex subunit B Clostridium ljungdahlii (strain ATCC 55383 / DSM 13528 / PETC)
Q8TSX9 6.6e-19 85 32 5 187 1 rnfB Ion-translocating oxidoreductase complex subunit B Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
H6LC27 4.19e-15 75 28 3 192 1 rnfB Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit B Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
H6LC27 1.33e-05 48 35 1 77 1 rnfB Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit B Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
Q55FT1 1.04e-07 54 48 2 62 2 pyd1 Dihydropyrimidine dehydrogenase [NADP(+)] Dictyostelium discoideum
Q57934 4.14e-07 52 27 3 118 4 MJ0514 Uncharacterized polyferredoxin-like protein MJ0514 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q56316 1.56e-06 48 35 1 80 1 porD Pyruvate synthase subunit PorD Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q18164 4.06e-06 50 42 2 68 3 dpyd-1 Dihydropyrimidine dehydrogenase [NADP(+)] Caenorhabditis elegans
O52682 5.48e-06 49 37 0 54 1 hydB Bifurcating [FeFe] hydrogenase beta subunit Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P13629 7.91e-06 48 36 2 84 3 hydA Periplasmic [Fe] hydrogenase large subunit Nitratidesulfovibrio oxamicus (strain Monticello)
P81292 1.15e-05 47 30 2 90 4 MJ0514.1 Uncharacterized polyferredoxin-like protein MJ0514.1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
H6LGM8 1.6e-05 48 44 1 49 1 carE Caffeyl-CoA reductase-Etf complex subunit CarE Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
Q8CHR6 1.81e-05 48 38 5 100 1 Dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Mus musculus
Q12882 4.26e-05 47 35 2 85 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Homo sapiens
Q5R895 4.76e-05 47 35 2 85 2 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Pongo abelii
Q28007 4.9e-05 47 36 2 85 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Bos taurus
A8XKG6 5.65e-05 46 43 4 69 3 dpyd-1 Probable dihydropyrimidine dehydrogenase [NADP(+)] Caenorhabditis briggsae
O58415 5.95e-05 43 37 0 54 3 porD Pyruvate synthase subunit PorD Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q50784 6.9e-05 46 41 0 53 4 mvhB Polyferredoxin protein MvhB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O89000 7.1e-05 46 36 4 91 2 Dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Rattus norvegicus
O58412 8.21e-05 43 32 1 77 3 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q28943 8.63e-05 46 36 2 85 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Sus scrofa
Q51800 0.000107 43 33 1 68 1 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9UYZ0 0.000198 42 32 1 77 3 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus abyssi (strain GE5 / Orsay)
Q9AIX6 0.000219 44 44 1 47 1 boxA Benzoyl-CoA oxygenase component A Aromatoleum evansii
P60232 0.000242 44 35 1 65 1 mvhB Polyferredoxin protein MvhB Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q9UYZ3 0.000428 41 35 0 54 3 porD Pyruvate synthase subunit PorD Pyrococcus abyssi (strain GE5 / Orsay)
Q51803 0.000538 41 35 0 54 1 porD Pyruvate synthase subunit PorD Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q46508 0.000671 43 29 7 124 1 hndD NADP-reducing hydrogenase subunit HndD Solidesulfovibrio fructosivorans
P80903 0.00074 40 37 1 54 1 porD Pyruvate synthase subunit PorD Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q58699 0.001 42 30 5 133 4 MJ1303 Uncharacterized polyferredoxin-like protein MJ1303 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_12760
Feature type CDS
Gene rsxB
Product electron transport complex subunit RsxB
Location 169349 - 169957 (strand: -1)
Length 609 (nucleotides) / 202 (amino acids)

Contig

Accession ZDB_369
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_926
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04060 Putative Fe-S cluster
PF14697 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2878 Energy production and conversion (C) C Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfB subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03616 H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] - -

Protein Sequence

MTMIWIAVAVLSLLGLAFGLILGYASRRFKVEEDPIVDKIDDILPQSQCGQCGFPGCRPYAESVANGGAINRCAPGGEQVMLKLADMLGVDPQPLDGDESVLNPVRKVAFIHEDQCIGCTKCIQACPVDAIIGATRAMHTVVEDLCTGCDLCVAPCPTDCIEMIPVAVTPRNWKWDLNTIPVRNIPADTGGTPVKPVQIEAS

Flanking regions ( +/- flanking 50bp)

GGTCTGATGTCTCTGGCCTTTATGGGCTTCAGTGGTCTGGTGAAATTCTGATGACAATGATTTGGATTGCCGTTGCCGTACTCAGCCTGCTGGGTCTGGCATTCGGTCTGATACTTGGTTACGCCTCCCGCCGCTTCAAAGTGGAGGAAGATCCCATTGTGGATAAGATTGATGACATTCTGCCGCAGAGTCAGTGCGGTCAGTGTGGTTTTCCGGGCTGCCGCCCGTATGCGGAATCTGTTGCCAACGGCGGTGCAATAAACCGCTGTGCCCCCGGCGGCGAGCAGGTGATGCTGAAACTGGCTGATATGCTGGGTGTGGATCCGCAGCCGCTCGACGGTGACGAATCCGTGCTCAATCCGGTGCGCAAAGTGGCCTTTATTCATGAAGATCAGTGCATCGGCTGCACCAAATGTATTCAGGCGTGTCCGGTGGATGCGATTATCGGTGCCACCCGCGCCATGCATACCGTGGTTGAAGATCTCTGCACCGGGTGTGATTTGTGTGTCGCGCCCTGCCCGACAGATTGCATTGAGATGATACCGGTCGCCGTCACCCCGCGTAACTGGAAGTGGGATTTAAACACCATTCCGGTCAGAAATATTCCGGCGGATACCGGCGGTACTCCTGTCAAACCTGTTCAGATTGAGGCGTCGTAAGTTTTATGTTCAATTTGCTCAACTTTCTGAAAAAAGACCGGGTATGGGAT