Homologs in group_993

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05030 FBDBKF_05030 75.7 Morganella morganii S1 rsxB electron transport complex subunit RsxB
EHELCC_12560 EHELCC_12560 75.7 Morganella morganii S2 rsxB electron transport complex subunit RsxB
NLDBIP_12900 NLDBIP_12900 75.7 Morganella morganii S4 rsxB electron transport complex subunit RsxB
LHKJJB_12760 LHKJJB_12760 75.7 Morganella morganii S3 rsxB electron transport complex subunit RsxB
HKOGLL_11375 HKOGLL_11375 75.7 Morganella morganii S5 rsxB electron transport complex subunit RsxB
F4V73_RS05470 F4V73_RS05470 77.2 Morganella psychrotolerans rsxB electron transport complex subunit RsxB

Distribution of the homologs in the orthogroup group_993

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_993

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q1CIY8 1.32e-109 314 75 0 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8U7 1.32e-109 314 75 0 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis bv. Antiqua (strain Angola)
Q8ZEC9 1.32e-109 314 75 0 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis
Q1C7K2 1.32e-109 314 75 0 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis bv. Antiqua (strain Antiqua)
B7NB82 2.12e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B2VEQ2 2.41e-104 301 75 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q3Z1Y3 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella sonnei (strain Ss046)
Q1RBG8 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain UTI89 / UPEC)
B1LEQ8 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain SMS-3-5 / SECEC)
B6IB63 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain SE11)
A1ABH3 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O1:K1 / APEC
B7NU05 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z462 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58323 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O157:H7
B7L5I1 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain 55989 / EAEC)
B7M9Y2 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZM88 2.85e-104 301 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O139:H28 (strain E24377A / ETEC)
B4T595 3.32e-104 301 75 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella newport (strain SL254)
B7LQP2 3.75e-104 301 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8ZPM1 6.48e-104 300 75 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N024 6.48e-104 300 75 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4THD5 6.48e-104 300 75 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella heidelberg (strain SL476)
B5FIE6 6.48e-104 300 75 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella dublin (strain CT_02021853)
P77223 6.55e-104 300 73 0 189 1 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain K12)
B1IQC6 6.55e-104 300 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0H1 6.55e-104 300 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O9:H4 (strain HS)
B1XF93 6.55e-104 300 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain K12 / DH10B)
C4ZY91 6.55e-104 300 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0I5 6.55e-104 300 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O8 (strain IAI1)
B2U2C7 8.52e-104 300 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q8FH96 1.07e-103 300 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MV10 1.17e-103 300 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O81 (strain ED1a)
B7URW9 1.29e-103 299 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q0THJ9 1.31e-103 299 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q83KY6 1.35e-103 299 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella flexneri
Q320Y5 1.35e-103 299 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella boydii serotype 4 (strain Sb227)
Q8Z6R0 1.57e-103 299 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella typhi
B4TV18 1.57e-103 299 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella schwarzengrund (strain CVM19633)
B5BKB1 1.57e-103 299 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi A (strain AKU_12601)
C0Q507 1.57e-103 299 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi C (strain RKS4594)
Q5PIC0 1.57e-103 299 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RAK1 1.57e-103 299 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV01 1.57e-103 299 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella enteritidis PT4 (strain P125109)
Q57PH9 1.57e-103 299 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella choleraesuis (strain SC-B67)
B5F6I9 1.57e-103 299 74 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella agona (strain SL483)
Q32FE5 2.26e-103 299 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella dysenteriae serotype 1 (strain Sd197)
A8AH09 2.81e-103 298 73 0 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MRW7 6.25e-102 295 73 0 189 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8GE01 3.19e-96 281 76 2 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Serratia proteamaculans (strain 568)
B5XWQ0 1.68e-94 276 73 0 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Klebsiella pneumoniae (strain 342)
C6DH16 1.55e-92 271 69 0 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BDE6 2.32e-92 271 71 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Edwardsiella ictaluri (strain 93-146)
A7MMM3 4.25e-92 270 75 0 167 3 rnfB Ion-translocating oxidoreductase complex subunit B Cronobacter sakazakii (strain ATCC BAA-894)
Q6D4W3 1.51e-91 269 68 0 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NSZ6 1.55e-87 259 64 2 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Sodalis glossinidius (strain morsitans)
B6EGH6 3.53e-86 255 63 2 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Aliivibrio salmonicida (strain LFI1238)
B5FCN4 1.69e-83 248 65 3 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Aliivibrio fischeri (strain MJ11)
Q5E6B7 1.69e-83 248 65 3 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MM82 7.34e-83 247 62 2 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio vulnificus (strain YJ016)
Q8D889 7.34e-83 247 62 2 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio vulnificus (strain CMCP6)
B8CM57 9.7e-83 246 59 2 191 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella piezotolerans (strain WP3 / JCM 13877)
A4SNP6 2.61e-81 243 69 3 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Aeromonas salmonicida (strain A449)
A8H537 1.79e-80 241 59 2 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q8EE80 2.16e-80 241 58 3 197 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0KLJ3 3.3e-80 240 68 3 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q0HVF6 5.72e-80 239 58 3 197 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sp. (strain MR-7)
A0KX80 6.97e-80 239 58 3 197 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sp. (strain ANA-3)
Q0HIH9 9.26e-80 239 58 3 197 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sp. (strain MR-4)
B7VLT8 4.43e-79 238 61 2 182 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio atlanticus (strain LGP32)
Q87MX3 2.47e-78 236 61 2 184 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C4LEP6 4.29e-78 234 59 2 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A7MVC6 5.24e-78 235 64 2 170 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio campbellii (strain ATCC BAA-1116)
P71396 2.15e-77 233 60 4 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UBJ1 2.15e-77 233 60 4 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus influenzae (strain PittEE)
Q4QJQ7 2.15e-77 233 60 4 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus influenzae (strain 86-028NP)
C3LTR4 1.35e-76 231 64 2 169 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio cholerae serotype O1 (strain M66-2)
Q9KT87 1.35e-76 231 64 2 169 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2R3 1.35e-76 231 64 2 169 1 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9CNP1 1.79e-76 231 60 2 179 3 rnfB Ion-translocating oxidoreductase complex subunit B Pasteurella multocida (strain Pm70)
A8FUX9 9.46e-75 226 61 2 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sediminis (strain HAW-EB3)
A3QEN5 1.97e-74 225 64 2 166 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1S6N0 1.05e-72 221 59 2 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q7VNT5 1.15e-71 219 59 3 176 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3SHB7 2.45e-71 218 55 2 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Thiobacillus denitrificans (strain ATCC 25259)
A1K5F2 1.82e-67 207 52 1 179 3 rnfB Ion-translocating oxidoreductase complex subunit B Azoarcus sp. (strain BH72)
A4XS52 6.52e-67 206 57 2 178 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas mendocina (strain ymp)
Q9HYB9 1.74e-66 205 56 3 176 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UWJ3 1.74e-66 205 56 3 176 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain LESB58)
Q5P1B1 2.01e-66 205 53 1 182 3 rnfB Ion-translocating oxidoreductase complex subunit B Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q02QX9 3.83e-66 204 56 3 176 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V1T8 4.13e-66 204 56 3 176 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain PA7)
Q0VP40 7.76e-66 204 61 1 159 3 rnfB Ion-translocating oxidoreductase complex subunit B Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q2SKU5 1.15e-65 203 56 2 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Hahella chejuensis (strain KCTC 2396)
A4VIV5 4.22e-63 197 56 2 173 3 rnfB Ion-translocating oxidoreductase complex subunit B Stutzerimonas stutzeri (strain A1501)
A0L5G7 1.83e-60 190 54 3 171 3 rnfB Ion-translocating oxidoreductase complex subunit B Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q0AAG8 1.7e-54 175 54 0 155 3 rnfB Ion-translocating oxidoreductase complex subunit B Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B8D719 1.99e-49 161 42 0 160 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57214 1.47e-48 159 41 0 160 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8R5 1.47e-48 159 41 0 160 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q8KA20 7.44e-48 157 41 2 161 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q3IXC5 1.57e-39 137 44 3 155 3 rnfB Ion-translocating oxidoreductase complex subunit B Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PRP4 4.53e-39 135 43 3 155 3 rnfB Ion-translocating oxidoreductase complex subunit B Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
D5ARZ0 5.59e-38 132 43 1 151 3 rnfB Ion-translocating oxidoreductase complex subunit B Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0CZ14 5.59e-38 132 43 1 151 1 rnfB Ion-translocating oxidoreductase complex subunit B Rhodobacter capsulatus
Q89AW9 7.44e-37 129 42 2 146 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
D8GR71 9.42e-26 103 31 4 192 3 rnfB Proton-translocating ferredoxin:NAD(+) oxidoreductase complex subunit B Clostridium ljungdahlii (strain ATCC 55383 / DSM 13528 / PETC)
H6LC27 2.42e-21 92 31 2 199 1 rnfB Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit B Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
H6LC27 9.65e-05 45 34 1 79 1 rnfB Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit B Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
Q8TSX9 2.3e-18 84 29 4 192 1 rnfB Ion-translocating oxidoreductase complex subunit B Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q55FT1 3.65e-09 59 51 2 62 2 pyd1 Dihydropyrimidine dehydrogenase [NADP(+)] Dictyostelium discoideum
Q57934 1.99e-07 53 30 3 116 4 MJ0514 Uncharacterized polyferredoxin-like protein MJ0514 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q57934 9.8e-05 45 39 1 64 4 MJ0514 Uncharacterized polyferredoxin-like protein MJ0514 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P13629 4.34e-06 50 38 1 78 3 hydA Periplasmic [Fe] hydrogenase large subunit Nitratidesulfovibrio oxamicus (strain Monticello)
O58412 4.45e-06 47 35 1 77 3 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q18164 9.59e-06 49 41 4 77 3 dpyd-1 Dihydropyrimidine dehydrogenase [NADP(+)] Caenorhabditis elegans
Q9UYZ0 9.88e-06 46 35 1 77 3 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus abyssi (strain GE5 / Orsay)
Q50784 9.95e-06 48 43 1 65 4 mvhB Polyferredoxin protein MvhB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O52682 1.04e-05 48 39 0 58 1 hydB Bifurcating [FeFe] hydrogenase beta subunit Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P81292 1.17e-05 47 34 1 63 4 MJ0514.1 Uncharacterized polyferredoxin-like protein MJ0514.1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q5R895 1.65e-05 48 38 2 85 2 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Pongo abelii
Q12882 1.71e-05 48 38 2 85 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Homo sapiens
H6LGM8 1.84e-05 48 44 1 49 1 carE Caffeyl-CoA reductase-Etf complex subunit CarE Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
P60232 2.22e-05 47 41 1 65 1 mvhB Polyferredoxin protein MvhB Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
A8XKG6 3.68e-05 47 41 2 67 3 dpyd-1 Probable dihydropyrimidine dehydrogenase [NADP(+)] Caenorhabditis briggsae
Q9AIX6 4.85e-05 47 38 2 67 1 boxA Benzoyl-CoA oxygenase component A Aromatoleum evansii
Q28007 6.45e-05 46 36 2 85 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Bos taurus
Q28943 6.63e-05 46 37 2 85 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Sus scrofa
Q51800 7.15e-05 43 33 1 68 1 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q58699 7.37e-05 46 36 7 135 4 MJ1303 Uncharacterized polyferredoxin-like protein MJ1303 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8CHR6 0.000122 45 37 2 85 1 Dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Mus musculus
O89000 0.000139 45 44 2 61 2 Dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Rattus norvegicus
Q7NG86 0.000779 40 39 2 58 1 psaC Photosystem I iron-sulfur center Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q85G47 0.000803 40 39 2 58 1 psaC Photosystem I iron-sulfur center Cyanidioschyzon merolae (strain NIES-3377 / 10D)
Q56316 0.000868 40 30 1 78 1 porD Pyruvate synthase subunit PorD Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P07598 0.001 43 42 1 52 1 hydA Periplasmic [Fe] hydrogenase large subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A4FPT3 0.001 42 32 2 79 3 nuoI NADH-quinone oxidoreductase subunit I Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS06295
Feature type CDS
Gene rsxB
Product electron transport complex subunit RsxB
Location 1379577 - 1380203 (strand: 1)
Length 627 (nucleotides) / 208 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_993
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04060 Putative Fe-S cluster
PF14697 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2878 Energy production and conversion (C) C Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfB subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03616 H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] - -

Protein Sequence

MNSLWIAIGVLGVLGLLFGLILGYSARRFKVEEDPIVEKIDAILPQSQCGQCGHPGCRPYAEAVANNGEMINRCAPGGEQVMLKIAELMGVDPQPLDGDEEALNPVRKVALIDEDNCIGCTKCIQACPVDAIVGATRAMHTIIEDLCTGCDLCVPPCPTDCITLVPVKMTTSNWKWDLNTIPVRNIPAEPEETPEDEPSLKTEDNAHV

Flanking regions ( +/- flanking 50bp)

GGTTTAATGTCTCTTGCCTTTATGGGTTTTAGTGGTTTGGTGAAACTGTAATGAATTCTTTATGGATAGCAATTGGTGTACTGGGTGTACTAGGGCTTCTATTCGGCCTGATTTTAGGTTATTCCGCTCGTCGCTTTAAAGTAGAAGAAGATCCTATTGTGGAAAAAATTGATGCCATATTACCACAGAGTCAGTGTGGTCAGTGTGGTCATCCTGGTTGCCGCCCTTATGCAGAAGCGGTAGCTAATAATGGAGAAATGATTAACCGTTGTGCACCGGGTGGTGAACAGGTTATGTTAAAAATTGCCGAACTGATGGGGGTTGATCCACAACCACTTGACGGTGATGAAGAAGCATTAAATCCGGTGAGAAAAGTGGCTTTAATTGATGAAGACAACTGCATCGGGTGCACAAAATGTATTCAAGCATGCCCAGTGGATGCCATCGTCGGCGCTACTCGTGCAATGCACACCATAATAGAAGATCTCTGCACAGGGTGTGATTTATGTGTTCCACCTTGTCCAACAGACTGTATTACTTTAGTTCCTGTGAAAATGACGACCTCTAATTGGAAATGGGATTTAAATACTATCCCTGTAAGAAATATTCCTGCAGAGCCAGAAGAAACACCCGAAGATGAACCGTCATTAAAGACGGAGGATAACGCTCATGTTTAATCTCTTTTCGTTATTTAAAAAAGATAAAATTTGGGATTTTAAAGGCGGCA