Homologs in group_993

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05030 FBDBKF_05030 92.1 Morganella morganii S1 rsxB electron transport complex subunit RsxB
EHELCC_12560 EHELCC_12560 92.1 Morganella morganii S2 rsxB electron transport complex subunit RsxB
NLDBIP_12900 NLDBIP_12900 92.1 Morganella morganii S4 rsxB electron transport complex subunit RsxB
LHKJJB_12760 LHKJJB_12760 92.1 Morganella morganii S3 rsxB electron transport complex subunit RsxB
HKOGLL_11375 HKOGLL_11375 92.1 Morganella morganii S5 rsxB electron transport complex subunit RsxB
PMI_RS06295 PMI_RS06295 77.2 Proteus mirabilis HI4320 rsxB electron transport complex subunit RsxB

Distribution of the homologs in the orthogroup group_993

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_993

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q1CIY8 2.88e-106 306 74 1 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis bv. Antiqua (strain Nepal516)
A9R8U7 2.88e-106 306 74 1 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis bv. Antiqua (strain Angola)
Q8ZEC9 2.88e-106 306 74 1 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis
Q1C7K2 2.88e-106 306 74 1 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Yersinia pestis bv. Antiqua (strain Antiqua)
B7NB82 1.74e-100 291 72 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B2VEQ2 2.9e-100 291 74 2 192 3 rnfB Ion-translocating oxidoreductase complex subunit B Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q0THJ9 2e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8AH09 2e-99 288 71 1 192 3 rnfB Ion-translocating oxidoreductase complex subunit B Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7LQP2 2.04e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q3Z1Y3 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella sonnei (strain Ss046)
Q1RBG8 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain UTI89 / UPEC)
B1LEQ8 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain SMS-3-5 / SECEC)
B6IB63 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain SE11)
A1ABH3 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O1:K1 / APEC
B7NU05 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z462 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58323 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O157:H7
B7L5I1 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain 55989 / EAEC)
B7M9Y2 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZM88 2.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O139:H28 (strain E24377A / ETEC)
B7URW9 4.31e-99 288 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P77223 5.6e-99 287 71 1 192 1 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain K12)
B1IQC6 5.6e-99 287 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A0H1 5.6e-99 287 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O9:H4 (strain HS)
B1XF93 5.6e-99 287 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain K12 / DH10B)
C4ZY91 5.6e-99 287 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0I5 5.6e-99 287 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O8 (strain IAI1)
Q83KY6 9.69e-99 287 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella flexneri
Q320Y5 9.69e-99 287 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella boydii serotype 4 (strain Sb227)
B7MV10 1.27e-98 286 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O81 (strain ED1a)
Q8FH96 1.6e-98 286 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q32FE5 2.2e-98 286 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella dysenteriae serotype 1 (strain Sd197)
B2U2C7 2.54e-98 286 71 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A8GE01 4.1e-98 285 75 1 191 3 rnfB Ion-translocating oxidoreductase complex subunit B Serratia proteamaculans (strain 568)
Q8Z6R0 5.77e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella typhi
B4TV18 5.77e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella schwarzengrund (strain CVM19633)
B5BKB1 5.77e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi A (strain AKU_12601)
C0Q507 5.77e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi C (strain RKS4594)
Q5PIC0 5.77e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RAK1 5.77e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV01 5.77e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella enteritidis PT4 (strain P125109)
Q57PH9 5.77e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella choleraesuis (strain SC-B67)
B5F6I9 5.77e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella agona (strain SL483)
Q8ZPM1 7.34e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N024 7.34e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4THD5 7.34e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella heidelberg (strain SL476)
B5FIE6 7.34e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella dublin (strain CT_02021853)
B4T595 8.84e-97 282 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella newport (strain SL254)
A9MRW7 3.01e-96 280 70 1 192 3 rsxB Ion-translocating oxidoreductase complex subunit B Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5XWQ0 8.38e-93 272 73 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Klebsiella pneumoniae (strain 342)
B6EGH6 1.45e-92 271 68 1 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Aliivibrio salmonicida (strain LFI1238)
Q7MM82 3.42e-91 268 68 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio vulnificus (strain YJ016)
Q8D889 3.42e-91 268 68 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio vulnificus (strain CMCP6)
A7MMM3 6.6e-90 265 73 1 170 3 rnfB Ion-translocating oxidoreductase complex subunit B Cronobacter sakazakii (strain ATCC BAA-894)
C6DH16 7.12e-90 265 68 1 192 3 rnfB Ion-translocating oxidoreductase complex subunit B Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4W3 2.71e-89 263 67 1 192 3 rnfB Ion-translocating oxidoreductase complex subunit B Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NSZ6 9.21e-89 261 64 1 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Sodalis glossinidius (strain morsitans)
B8CM57 5.54e-88 259 60 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella piezotolerans (strain WP3 / JCM 13877)
A4SNP6 1.46e-86 256 72 2 167 3 rnfB Ion-translocating oxidoreductase complex subunit B Aeromonas salmonicida (strain A449)
C5BDE6 2.25e-86 255 65 0 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Edwardsiella ictaluri (strain 93-146)
A8H537 2.56e-86 255 60 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B7VLT8 2.72e-86 255 71 1 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio atlanticus (strain LGP32)
B5FCN4 3.16e-86 255 70 1 171 3 rnfB Ion-translocating oxidoreductase complex subunit B Aliivibrio fischeri (strain MJ11)
Q5E6B7 3.16e-86 255 70 1 171 3 rnfB Ion-translocating oxidoreductase complex subunit B Aliivibrio fischeri (strain ATCC 700601 / ES114)
A0KLJ3 9.29e-86 254 71 2 167 3 rnfB Ion-translocating oxidoreductase complex subunit B Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A7MVC6 1.05e-85 254 67 1 178 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio campbellii (strain ATCC BAA-1116)
Q87MX3 9.86e-85 251 71 1 168 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LTR4 4.4e-84 250 68 2 176 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio cholerae serotype O1 (strain M66-2)
Q9KT87 4.4e-84 250 68 2 176 3 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2R3 4.4e-84 250 68 2 176 1 rnfB Ion-translocating oxidoreductase complex subunit B Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A0KX80 4.7e-84 249 60 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sp. (strain ANA-3)
Q0HVF6 6.17e-84 249 60 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sp. (strain MR-7)
Q8EE80 1.01e-83 249 59 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HIH9 1.33e-83 248 59 1 189 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sp. (strain MR-4)
C4LEP6 2.02e-80 240 57 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A8FUX9 7e-79 236 63 1 167 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella sediminis (strain HAW-EB3)
A3QEN5 7.4e-79 236 66 1 165 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P71396 7.05e-78 234 59 3 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UBJ1 7.05e-78 234 59 3 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus influenzae (strain PittEE)
Q4QJQ7 7.05e-78 234 59 3 188 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus influenzae (strain 86-028NP)
A1S6N0 9.77e-76 228 58 1 185 3 rnfB Ion-translocating oxidoreductase complex subunit B Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q9CNP1 9.79e-76 229 57 1 178 3 rnfB Ion-translocating oxidoreductase complex subunit B Pasteurella multocida (strain Pm70)
Q7VNT5 4.06e-75 228 57 2 187 3 rnfB Ion-translocating oxidoreductase complex subunit B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q2SKU5 1.08e-74 226 60 1 184 3 rnfB Ion-translocating oxidoreductase complex subunit B Hahella chejuensis (strain KCTC 2396)
A4XS52 1.83e-71 218 60 1 173 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas mendocina (strain ymp)
Q3SHB7 2.63e-71 217 56 3 186 3 rnfB Ion-translocating oxidoreductase complex subunit B Thiobacillus denitrificans (strain ATCC 25259)
A1K5F2 8.49e-70 213 55 2 179 3 rnfB Ion-translocating oxidoreductase complex subunit B Azoarcus sp. (strain BH72)
Q0VP40 2.42e-69 213 62 0 158 3 rnfB Ion-translocating oxidoreductase complex subunit B Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A6V1T8 5.26e-69 211 57 2 175 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain PA7)
Q5P1B1 5.88e-69 211 57 2 179 3 rnfB Ion-translocating oxidoreductase complex subunit B Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9HYB9 1.52e-68 210 56 2 175 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UWJ3 1.52e-68 210 56 2 175 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain LESB58)
Q02QX9 2.54e-68 209 56 2 175 3 rnfB Ion-translocating oxidoreductase complex subunit B Pseudomonas aeruginosa (strain UCBPP-PA14)
A4VIV5 1.29e-67 208 62 2 156 3 rnfB Ion-translocating oxidoreductase complex subunit B Stutzerimonas stutzeri (strain A1501)
A0L5G7 9.95e-59 185 54 3 170 3 rnfB Ion-translocating oxidoreductase complex subunit B Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q0AAG8 1.34e-54 175 57 1 155 3 rnfB Ion-translocating oxidoreductase complex subunit B Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B8D719 1.79e-45 151 40 1 160 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57214 6.91e-45 149 40 1 160 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8R5 6.91e-45 149 40 1 160 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q8KA20 9.36e-44 146 40 3 161 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q3IXC5 1.95e-40 139 45 3 157 3 rnfB Ion-translocating oxidoreductase complex subunit B Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PRP4 7.33e-40 137 44 3 157 3 rnfB Ion-translocating oxidoreductase complex subunit B Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
D5ARZ0 4.58e-39 135 45 2 151 3 rnfB Ion-translocating oxidoreductase complex subunit B Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0CZ14 4.58e-39 135 45 2 151 1 rnfB Ion-translocating oxidoreductase complex subunit B Rhodobacter capsulatus
Q89AW9 3.19e-34 122 41 3 147 3 rnfB Ion-translocating oxidoreductase complex subunit B Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
D8GR71 8.58e-28 108 30 3 194 3 rnfB Proton-translocating ferredoxin:NAD(+) oxidoreductase complex subunit B Clostridium ljungdahlii (strain ATCC 55383 / DSM 13528 / PETC)
Q8TSX9 1.27e-18 84 28 5 213 1 rnfB Ion-translocating oxidoreductase complex subunit B Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
H6LC27 8.44e-17 80 28 4 202 1 rnfB Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit B Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
H6LC27 5.61e-06 49 36 1 80 1 rnfB Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit B Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
Q55FT1 1.41e-08 57 47 2 65 2 pyd1 Dihydropyrimidine dehydrogenase [NADP(+)] Dictyostelium discoideum
Q57934 2.24e-08 55 30 3 118 4 MJ0514 Uncharacterized polyferredoxin-like protein MJ0514 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q18164 6.25e-07 52 38 5 99 3 dpyd-1 Dihydropyrimidine dehydrogenase [NADP(+)] Caenorhabditis elegans
O52682 2.62e-06 50 37 0 54 1 hydB Bifurcating [FeFe] hydrogenase beta subunit Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O89000 5.34e-06 49 37 4 90 2 Dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Rattus norvegicus
Q8CHR6 6.44e-06 49 37 4 91 1 Dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Mus musculus
Q12882 6.68e-06 49 37 2 89 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Homo sapiens
Q5R895 6.94e-06 49 37 2 89 2 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Pongo abelii
P13629 1.03e-05 48 37 1 78 3 hydA Periplasmic [Fe] hydrogenase large subunit Nitratidesulfovibrio oxamicus (strain Monticello)
Q56316 1.19e-05 45 34 1 78 1 porD Pyruvate synthase subunit PorD Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q50784 1.32e-05 48 45 0 53 4 mvhB Polyferredoxin protein MvhB Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q28007 1.86e-05 48 34 2 89 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Bos taurus
H6LGM8 2.04e-05 47 34 2 88 1 carE Caffeyl-CoA reductase-Etf complex subunit CarE Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1)
A8XKG6 2.38e-05 47 41 2 65 3 dpyd-1 Probable dihydropyrimidine dehydrogenase [NADP(+)] Caenorhabditis briggsae
Q28943 3.64e-05 47 34 2 89 1 DPYD Dihydropyrimidine dehydrogenase [NADP(+)] Sus scrofa
P60232 3.8e-05 47 38 1 65 1 mvhB Polyferredoxin protein MvhB Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q9LID6 0.000151 45 30 5 93 2 ABCE1 ABC transporter E family member 1 Arabidopsis thaliana
P81292 0.000176 43 28 2 90 4 MJ0514.1 Uncharacterized polyferredoxin-like protein MJ0514.1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P80903 0.000196 42 38 1 54 1 porD Pyruvate synthase subunit PorD Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
O58415 0.000276 42 35 0 54 3 porD Pyruvate synthase subunit PorD Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O58412 0.000314 42 31 1 77 3 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9VSS1 0.000352 44 28 5 94 1 pix Protein Pixie Drosophila melanogaster
Q51800 0.000411 41 32 1 68 1 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q6NYG8 0.000436 44 34 3 85 2 dpyd Dihydropyrimidine dehydrogenase [NADP(+)] Danio rerio
Q46508 0.000464 43 29 7 124 1 hndD NADP-reducing hydrogenase subunit HndD Solidesulfovibrio fructosivorans
Q9UYZ0 0.000677 41 31 1 77 3 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus abyssi (strain GE5 / Orsay)
Q9AIX6 0.000759 43 42 1 47 1 boxA Benzoyl-CoA oxygenase component A Aromatoleum evansii

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05470
Feature type CDS
Gene rsxB
Product electron transport complex subunit RsxB
Location 1163274 - 1163882 (strand: 1)
Length 609 (nucleotides) / 202 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_993
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04060 Putative Fe-S cluster
PF14697 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2878 Energy production and conversion (C) C Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfB subunit

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03616 H+/Na+-translocating ferredoxin:NAD+ oxidoreductase subunit B [EC:7.1.1.11 7.2.1.2] - -

Protein Sequence

MTIIWIAVAVLSLFGLLFGLILGYASRRFKVEEDPIVDKIDDILPQSQCGQCGFPGCRPYAESVANGGAINRCAPGGEQVMLKLADMLGVDPQPLDGDESALNPVRKVAFIHEDQCIGCTKCIQACPVDAIVGATRAMHTVIEDLCTGCDLCVAPCPVDCIEMIPVATTTHNWKWDLNSIPVRNIPAEPAASPVKPVQIEAS

Flanking regions ( +/- flanking 50bp)

GGTCTGATGTCTCTCGCCTTTATGGGCTTCAGTGGTCTGGTGAAATTCTGATGACGATTATATGGATTGCCGTCGCCGTGCTCAGCCTGTTCGGGCTGCTGTTCGGGCTGATACTCGGCTATGCCTCCCGCCGCTTTAAAGTGGAGGAAGATCCGATTGTTGATAAAATCGACGATATTCTGCCACAAAGCCAGTGCGGGCAATGCGGGTTTCCGGGCTGCCGCCCTTATGCGGAATCTGTTGCTAATGGTGGCGCGATAAACCGCTGCGCGCCGGGCGGTGAGCAGGTGATGCTGAAACTGGCGGATATGCTGGGTGTTGATCCGCAACCGCTCGACGGTGACGAATCAGCCCTGAATCCTGTCCGTAAAGTGGCCTTTATCCATGAAGATCAGTGTATCGGCTGCACGAAATGTATTCAGGCGTGCCCGGTGGATGCCATTGTCGGTGCCACCCGCGCTATGCATACCGTGATTGAAGATCTCTGCACCGGCTGTGATTTGTGTGTCGCGCCCTGCCCGGTGGATTGTATCGAAATGATCCCGGTCGCTACCACGACGCACAACTGGAAATGGGATTTAAACAGTATTCCGGTCAGAAATATTCCGGCAGAGCCTGCTGCATCCCCGGTCAAACCCGTTCAGATTGAGGCGTCATAAGTTTTATGTTTAATTTACTCAATTTATTGAAAAAAGACCGGGTCTGGGAT