Homologs in group_3078

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18840 FBDBKF_18840 100.0 Morganella morganii S1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
EHELCC_17035 EHELCC_17035 100.0 Morganella morganii S2 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
NLDBIP_18415 NLDBIP_18415 100.0 Morganella morganii S4 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
HKOGLL_08760 HKOGLL_08760 100.0 Morganella morganii S5 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
F4V73_RS13755 F4V73_RS13755 90.1 Morganella psychrotolerans - ATP-binding cassette domain-containing protein

Distribution of the homologs in the orthogroup group_3078

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3078

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q05596 2.42e-125 360 65 0 263 1 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5N5 3.56e-125 360 65 0 263 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhi
Q5PDU4 3.68e-125 360 65 0 263 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Y7R4 5.83e-100 296 53 1 267 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q720M2 4.79e-99 294 53 1 267 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q92CK1 4.59e-98 291 53 1 260 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q58488 1.74e-69 219 46 1 238 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q0TUN8 8.88e-68 215 44 2 241 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8XNY7 1.34e-67 214 43 2 241 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q0SWH9 3.75e-67 213 43 2 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q8TK65 1.21e-63 209 40 2 271 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q6LX68 3.93e-62 200 40 2 244 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q50801 9.97e-62 199 45 1 224 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
O26236 7.49e-61 197 44 0 216 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q2NHA1 1.57e-60 196 42 1 243 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q8PZN0 9.23e-60 199 39 1 246 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8TTN2 1.7e-59 198 40 1 252 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8KFD6 3.11e-58 191 42 1 228 3 CT0391 Putative ABC transporter ATP-binding protein CT0391 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q2FRT7 5.23e-58 193 42 0 230 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
A3CVD3 3.53e-57 187 43 3 244 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q8YQ88 8.19e-57 186 38 0 231 3 alr3946 Putative ABC transporter ATP-binding protein alr3946 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
O27739 8.86e-57 187 39 1 243 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q2FNX9 2.16e-56 185 41 2 228 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q51719 1.97e-54 181 41 1 225 3 None Putative ABC transporter ATP-binding protein in cobA 5'region Propionibacterium freudenreichii subsp. shermanii
O68106 3.92e-53 177 37 3 278 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8TIX0 4.4e-53 178 38 3 247 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q3ABN1 4e-52 174 38 3 243 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
O54187 4.53e-51 172 36 3 249 3 SCO5958 Putative ABC transporter ATP-binding protein SCO5958 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8PYH5 1.94e-49 169 36 3 247 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8R7Y5 3.63e-49 167 38 4 260 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
O29527 9.1e-48 164 38 0 223 3 AF_0731 Putative ABC transporter ATP-binding protein AF_0731 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q74DN5 2.69e-47 161 37 6 259 3 GSU1281 Putative ABC transporter ATP-binding protein GSU1281 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q73KT5 3.88e-47 161 37 2 241 3 TDE_2132 Putative ABC transporter ATP-binding protein TDE_2132 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q748K0 6.99e-47 161 36 5 262 3 GSU3001 Putative ABC transporter ATP-binding protein GSU3001 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q1WSB8 9.9e-47 160 37 4 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
Q97JB8 2.61e-46 159 37 3 245 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q5L3R0 5.83e-46 159 37 5 259 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
Q9RKC6 2.62e-45 156 35 3 240 3 SCO3161 Putative ABC transporter ATP-binding protein SCO3161 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q65P77 6.02e-45 156 36 5 263 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q18CI9 7.71e-45 156 38 3 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridioides difficile (strain 630)
O57872 9.19e-45 155 35 5 252 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8U4L3 9.6e-45 155 37 6 260 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P40735 1.42e-44 155 35 8 278 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
Q8R7Y4 6.08e-44 153 37 3 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8U3E0 6.16e-44 153 34 4 258 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q4A5A5 1.77e-43 152 31 6 266 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q8DG84 4.44e-43 151 35 1 229 3 tll2439 Putative ABC transporter ATP-binding protein tll2439 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q839D5 9.57e-43 150 35 4 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8RHL0 1.2e-42 149 33 3 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5L3Q9 1.38e-42 150 40 5 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Geobacillus kaustophilus (strain HTA426)
Q8XHV3 1.77e-42 150 36 3 233 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain 13 / Type A)
Q0TMS8 1.77e-42 150 36 3 233 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q9HMZ4 2.71e-42 147 36 2 237 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q8VNL9 3.3e-42 149 35 5 251 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
Q03EE4 4.11e-42 149 35 4 242 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A3DJK5 5.8e-42 148 36 4 249 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q9V1Q4 8.85e-42 148 35 4 252 3 PYRAB03730 Putative ABC transporter ATP-binding protein PYRAB03730 Pyrococcus abyssi (strain GE5 / Orsay)
Q38UU0 9.24e-42 148 37 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q67JX4 9.64e-42 148 38 1 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q9HPH7 1.1e-41 146 37 1 227 3 VNG_1631G Putative ABC transporter ATP-binding protein VNG_1631G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q49ZE0 1.25e-41 147 36 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A0PXX7 1.29e-41 147 34 3 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium novyi (strain NT)
Q839D4 1.42e-41 147 36 6 249 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
O59479 1.6e-41 147 35 4 252 3 PH1815 Putative ABC transporter ATP-binding protein PH1815 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q82HA2 2.56e-41 146 34 3 241 3 SAV_3608 Putative ABC transporter ATP-binding protein SAV_3608 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q18CJ0 4.47e-41 146 35 4 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
Q8PSR0 6.78e-41 152 34 2 243 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 8.63e-35 135 29 6 274 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8CRI6 1.07e-40 144 34 4 254 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM27 1.07e-40 144 34 4 254 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2LY16 1.21e-40 145 35 3 239 3 cbiO Cobalt import ATP-binding protein CbiO Syntrophus aciditrophicus (strain SB)
Q8DRR9 1.71e-40 144 35 4 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2RFS8 2.09e-40 144 35 4 245 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q97EK9 2.26e-40 144 34 6 267 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q1J982 2.33e-40 144 35 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8XHV2 2.55e-40 144 36 5 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain 13 / Type A)
Q0TMS7 2.55e-40 144 36 5 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8DWR3 2.59e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 2.59e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 2.59e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P0C0E9 3.27e-40 144 34 6 273 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 3.27e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 3.27e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 3.27e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 3.27e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 3.27e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 3.27e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 3.27e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9V2E4 4.53e-40 143 34 4 247 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q48QM2 4.6e-40 143 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 4.6e-40 143 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 4.6e-40 143 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q73F67 5.36e-40 143 32 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q7N0N3 8.77e-40 141 37 5 223 3 plu3849 Putative ABC transporter ATP-binding protein plu3849 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A3DJK3 9.69e-40 142 37 3 232 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q81J16 2.38e-39 141 32 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HPN0 2.51e-39 141 32 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 2.51e-39 141 32 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 2.51e-39 141 32 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q9CIS9 2.53e-39 141 34 4 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q0SQH5 2.65e-39 141 35 5 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain SM101 / Type A)
Q8ETV7 3.33e-39 141 34 4 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q55740 3.89e-39 141 34 3 244 3 sll0385 Putative ABC transporter ATP-binding protein sll0385 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q63H62 4.22e-39 141 32 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q890R3 4.57e-39 141 33 2 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium tetani (strain Massachusetts / E88)
P70970 4.83e-39 140 37 4 224 3 ecfAB Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus subtilis (strain 168)
Q7A470 5.88e-39 140 34 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 5.88e-39 140 34 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q38UT9 7.5e-39 140 32 5 262 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q6GEL3 8.1e-39 140 34 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
Q927N8 8.14e-39 140 34 7 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5HDY6 9.2e-39 139 34 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 9.2e-39 139 34 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 9.2e-39 139 34 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
A0PXX8 9.62e-39 140 33 2 230 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium novyi (strain NT)
Q03I83 1.37e-38 139 36 3 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M244 1.37e-38 139 36 3 231 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ4 1.37e-38 139 36 3 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain CNRZ 1066)
Q2YYM4 1.44e-38 139 34 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6MSQ2 1.45e-38 140 34 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q8DQY5 1.73e-38 145 35 2 237 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 1.83e-25 108 32 7 264 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8RD07 1.93e-38 138 34 3 222 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q48QM3 2.08e-38 139 33 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RH10 2.15e-38 139 33 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J450 2.15e-38 139 33 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC9 2.15e-38 139 33 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJD0 2.15e-38 139 33 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J983 2.15e-38 139 33 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMM8 2.15e-38 139 33 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B6 2.15e-38 139 33 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XI2 2.15e-38 139 33 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M1
Q67JX3 2.69e-38 139 35 6 270 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q1WSB9 3.2e-38 139 37 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
P0CZ27 3.32e-38 138 32 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 3.32e-38 138 32 5 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8NVB5 3.67e-38 138 34 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 3.67e-38 138 34 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
Q97SA3 4.13e-38 144 35 2 237 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97SA3 1.04e-26 112 33 8 265 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q6F1W5 4.59e-38 141 35 4 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q72D73 5.46e-38 137 37 4 218 3 DVU_1056 Putative ABC transporter ATP-binding protein DVU_1056 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q9KGD6 6.25e-38 138 38 4 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q65P76 6.52e-38 138 37 3 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8Y454 6.82e-38 137 33 7 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q88XV1 7.51e-38 138 39 6 229 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q2SRI2 7.64e-38 138 34 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q71WH7 9.37e-38 137 33 7 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
Q8DMX9 9.86e-38 137 33 5 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 9.86e-38 137 33 5 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 9.86e-38 137 33 5 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q035B2 1.11e-37 137 36 3 228 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A3CRB9 1.27e-37 137 33 8 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q04EY4 1.38e-37 137 30 5 279 3 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A3CRB8 1.56e-37 137 33 4 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
Q6XYZ3 1.79e-37 137 32 4 257 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Spiroplasma kunkelii
Q6F1W4 2.18e-37 137 35 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q8TQ05 2.22e-37 142 31 2 248 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 8.06e-33 129 32 6 254 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q74L62 2.85e-37 136 33 5 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q97EK8 2.94e-37 136 32 4 256 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q032H4 3.12e-37 136 34 4 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 3.12e-37 136 34 4 242 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
Q8DRS0 3.22e-37 136 33 4 248 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5FM62 3.3e-37 136 33 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A0ALT7 4.96e-37 135 32 5 257 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q88XV2 5.15e-37 135 33 4 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q890R2 5.32e-37 135 32 5 254 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium tetani (strain Massachusetts / E88)
Q045Z7 9.39e-37 135 34 2 230 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8CRI7 1.23e-36 134 32 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM28 1.55e-36 134 33 6 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
D5AQY6 1.64e-36 133 32 2 243 1 nikO Nickel import ATP-binding protein NikO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8TI16 1.69e-36 134 34 4 243 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8DWR4 2.19e-36 134 38 3 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 2.19e-36 134 38 3 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 2.19e-36 134 38 3 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A0R8K9 3.17e-36 134 32 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q8EUF1 3.56e-36 133 30 4 252 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Malacoplasma penetrans (strain HF-2)
Q98QH5 4.05e-36 132 32 5 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q035B3 4.22e-36 133 37 4 221 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q97N51 4.31e-36 133 36 6 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8DMY0 4.64e-36 133 36 6 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV8 4.64e-36 133 36 6 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q03PY6 6.83e-36 132 39 4 213 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A2RI02 7.72e-36 132 36 3 213 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q50293 8.62e-36 133 31 4 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q890D1 8.63e-36 131 36 1 198 2 larO Nickel import ATP-binding protein LarO Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6KHL1 8.65e-36 132 30 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q7NAQ6 9.44e-36 132 32 6 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q74L61 9.46e-36 132 34 2 220 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q6HPM9 1.12e-35 132 32 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 1.12e-35 132 32 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
Q8ETV6 1.14e-35 132 33 7 256 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q81J15 1.16e-35 132 32 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9CIS8 1.18e-35 132 36 3 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q8PY27 1.31e-35 131 34 4 243 3 MM_1037 Putative ABC transporter ATP-binding protein MM_1037 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q03ZL5 1.75e-35 131 37 2 212 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q73F66 1.82e-35 132 32 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q0AUL1 1.87e-35 131 32 4 237 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P47425 2.08e-35 131 30 2 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q03ZL6 2.53e-35 130 32 5 249 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q8XK20 3.27e-35 136 31 2 243 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 2.11e-24 105 31 6 252 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q032H3 4.46e-35 130 36 3 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
Q5M243 4.99e-35 130 32 6 271 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ3 4.99e-35 130 32 6 271 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain CNRZ 1066)
Q03I82 5.91e-35 130 32 6 271 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q93D97 2e-34 134 32 5 256 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93D97 6.7e-27 112 32 8 274 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q98QH4 2.19e-34 129 32 4 236 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8PUE7 2.29e-34 133 31 1 222 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 2.86e-25 107 28 3 219 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q1GBJ0 2.66e-34 128 33 4 247 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A0ALT6 3.5e-34 128 34 6 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q6XYZ4 4.75e-34 128 30 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Spiroplasma kunkelii
Q927N9 4.85e-34 128 34 6 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8TYV9 5.01e-34 127 31 3 241 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q88ZZ2 5.23e-34 132 33 4 248 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 2.86e-26 110 33 9 252 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q50294 5.71e-34 127 29 2 250 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q71WH8 6.65e-34 127 34 6 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q5FM63 6.81e-34 127 30 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q04BY7 8.05e-34 127 33 4 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q737I0 8.28e-34 132 31 2 249 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 7.51e-24 103 30 7 261 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q4A8A2 9.44e-34 127 31 4 252 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain 7448)
Q601T5 9.44e-34 127 31 4 252 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain 232)
Q4L884 1.01e-33 127 34 7 233 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus haemolyticus (strain JCSC1435)
Q8Y455 1.01e-33 127 34 6 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9PPV1 1.05e-33 127 32 4 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q9X1Z1 1.48e-33 125 31 5 248 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q4L885 1.75e-33 126 31 4 239 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
Q87G35 1.83e-33 131 30 3 250 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 5.18e-25 107 30 6 255 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q04FM1 2.66e-33 126 34 5 225 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q04BY6 2.78e-33 125 32 4 226 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBI9 2.78e-33 125 32 4 226 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q4AA75 3.02e-33 125 30 4 252 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q04EY5 4.79e-33 125 30 5 258 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q03PY5 5.23e-33 125 33 6 248 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q045Z8 5.28e-33 125 32 5 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8TI15 5.49e-33 125 32 7 242 3 MA_4342 Putative ABC transporter ATP-binding protein MA_4342 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q6FAN3 9.96e-33 126 35 4 231 3 metN1 Methionine import ATP-binding protein MetN 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q97KZ3 1.2e-32 123 31 1 215 3 CA_C0773 Putative ABC transporter ATP-binding protein CA_C0773 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q6G4Q8 1.42e-32 122 34 4 210 3 BH02760 Putative ABC transporter ATP-binding protein BH02760 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q7NAQ7 1.73e-32 124 29 2 237 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q6G1D9 1.77e-32 122 34 4 205 3 BQ02700 Putative ABC transporter ATP-binding protein BQ02700 Bartonella quintana (strain Toulouse)
Q3A9G5 2.46e-32 124 35 5 241 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q5HCL3 2.84e-32 128 31 4 248 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q5HCL3 9.7e-20 92 29 8 254 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q7NNW9 3.97e-32 122 33 5 242 3 gll0289 Putative ABC transporter ATP-binding protein gll0289 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q8NUH8 4.26e-32 127 31 4 248 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q8NUH8 6.98e-19 89 29 8 254 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q6G5Z1 4.26e-32 127 31 4 248 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q6G5Z1 6.98e-19 89 29 8 254 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q99QV7 4.3e-32 127 31 4 248 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q99QV7 9.34e-20 92 29 8 254 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A342 4.3e-32 127 31 4 248 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q7A342 9.34e-20 92 29 8 254 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q8PY26 4.87e-32 122 34 5 207 3 MM_1038 Putative ABC transporter ATP-binding protein MM_1038 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8ES39 5.07e-32 127 32 2 242 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 1.12e-29 120 29 8 271 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q49ZD9 6.53e-32 122 30 4 235 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9Z9J3 6.89e-32 122 32 4 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6GDC0 6.99e-32 127 30 2 246 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q6GDC0 1.08e-20 95 30 9 255 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
P47426 1.19e-31 122 29 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q63H61 1.27e-31 121 33 6 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ZK / E33L)
Q832R5 1.58e-31 125 30 3 259 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 6.24e-26 110 31 6 262 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q7MFH3 2.02e-31 125 31 3 244 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 2.63e-22 99 30 6 244 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q81PZ8 2.04e-31 125 29 2 249 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 2.16e-27 114 33 6 251 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q6HI76 2.39e-31 125 29 2 249 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 7.62e-28 115 33 6 251 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q58967 4.87e-31 120 31 5 223 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8TIW9 6.32e-31 119 34 2 201 3 MA_4021 Putative ABC transporter ATP-binding protein MA_4021 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q2YYM5 6.92e-31 119 31 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8TQW9 8.25e-31 123 31 1 222 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 8.31e-27 112 28 5 251 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9PPV2 9.66e-31 122 36 2 181 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q73F11 1.01e-30 120 34 4 228 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6GEL4 1.08e-30 119 31 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MRSA252)
Q8D3Z9 1.12e-30 123 30 3 244 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 1.07e-22 100 30 6 244 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q5PCG9 1.29e-30 120 37 6 212 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q81IZ6 1.37e-30 120 34 3 218 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8R9L8 1.91e-30 122 30 1 242 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R9L8 2.84e-23 102 29 6 245 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q81CT8 1.99e-30 122 29 2 249 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 6.32e-26 110 32 6 251 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q88ZJ6 2.7e-30 119 32 5 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8TUR7 3.43e-30 117 33 7 234 3 pstB Phosphate import ATP-binding protein PstB Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q81VM2 3.91e-30 119 34 4 228 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q57S53 3.96e-30 119 36 7 225 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q63H29 4.29e-30 119 34 4 228 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q13LD8 4.67e-30 119 38 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q7A088 5.17e-30 117 31 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MW2)
Q6G7A0 5.17e-30 117 31 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MSSA476)
Q7A471 5.17e-30 117 31 6 238 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain N315)
Q99S48 5.17e-30 117 31 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY7 5.17e-30 117 31 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain COL)
Q2FW35 5.17e-30 117 31 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER8 5.17e-30 117 31 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain USA300)
Q8E3S6 8.24e-30 120 30 3 256 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8E3S6 4.72e-24 104 32 7 244 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q4A5A4 8.85e-30 117 29 3 247 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis synoviae (strain 53)
Q8ZR89 9.08e-30 117 37 6 212 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z8R5 9.66e-30 117 37 6 212 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q8DY60 1.02e-29 120 30 3 256 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY60 7.64e-24 103 32 7 244 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q0BMC9 1.33e-29 117 33 4 230 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 1.33e-29 117 33 4 230 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q6YR39 1.54e-29 115 32 3 245 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q8G838 1.65e-29 120 29 3 251 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 8.94e-22 98 33 2 188 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q74I62 1.81e-29 120 30 2 234 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q74I62 6.26e-19 89 28 6 252 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q032A0 2.09e-29 117 32 7 265 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain SK11)
D8KFN1 2.99e-29 117 32 7 265 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain NZ9000)
P0CI33 2.99e-29 117 32 7 265 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain MG1363)
Q6YRJ4 3.74e-29 119 29 2 246 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q6YRJ4 7e-19 89 26 5 260 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q02ME3 4.22e-29 116 35 4 228 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6KHL2 5.21e-29 115 28 3 243 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q18C09 5.58e-29 115 32 3 227 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q6LQ00 6.31e-29 118 29 3 255 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 1.39e-23 103 30 8 272 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q2NIT5 6.54e-29 114 31 3 245 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
A3DDF6 7.18e-29 115 31 4 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q9RRL9 8.35e-29 112 34 6 226 3 DR_2469 Putative ABC transporter ATP-binding protein DR_2469 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q4A8A1 8.59e-29 114 31 2 223 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain 7448)
Q14H97 1.08e-28 115 32 4 231 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q1BR30 1.18e-28 115 38 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia orbicola (strain AU 1054)
A0B344 1.18e-28 115 38 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia cenocepacia (strain HI2424)
Q4AA74 1.37e-28 114 30 2 223 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q601T6 1.37e-28 114 30 2 223 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain 232)
P54537 1.45e-28 112 29 3 226 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q03PF2 1.64e-28 115 32 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q39AT4 3.03e-28 114 37 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5NFU5 3.12e-28 114 32 4 231 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q5KVK2 3.54e-28 113 35 3 208 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q8TSC8 4.58e-28 116 30 3 244 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TSC8 7.76e-26 110 29 4 248 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q7AH43 4.8e-28 113 29 5 235 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q6F0V4 5.11e-28 113 31 5 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q9CIN4 6.29e-28 113 32 8 265 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. lactis (strain IL1403)
Q8RHK9 6.46e-28 111 31 6 249 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9I1C8 6.79e-28 113 35 4 228 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2SRI1 7.09e-28 114 29 9 261 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8CQS7 7.77e-28 112 32 4 231 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRU5 7.77e-28 112 32 4 231 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q38WL5 7.91e-28 112 33 3 210 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q0B6I6 1.17e-27 113 37 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q13VD7 1.27e-27 112 35 3 212 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q8PVG9 1.29e-27 115 29 4 254 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PVG9 1.31e-27 115 31 4 245 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q97KD5 1.34e-27 111 32 5 228 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q5L222 1.48e-27 112 29 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q3JHC9 2.12e-27 112 37 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain 1710b)
Q8ELA5 2.41e-27 111 33 3 218 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q63NI4 2.54e-27 112 37 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain K96243)
Q62B84 2.76e-27 112 37 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia mallei (strain ATCC 23344)
Q0SRL2 2.79e-27 111 30 4 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
Q6MSQ1 3.58e-27 112 28 8 261 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q5SLN1 4.18e-27 109 31 5 235 3 pstB Phosphate import ATP-binding protein PstB Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5WVL8 4.28e-27 110 31 3 229 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q8XIZ5 4.86e-27 110 31 4 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 4.86e-27 110 31 4 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
O32169 4.94e-27 110 32 4 231 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q5FKL2 5.17e-27 110 34 4 204 3 metN Methionine import ATP-binding protein MetN Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q9CGD4 5.23e-27 112 32 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. lactis (strain IL1403)
Q9S4Z0 5.72e-27 110 34 8 241 3 metN Methionine import ATP-binding protein MetN Salmonella enteritidis
Q1LQF6 6.23e-27 110 34 3 214 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A0PY57 7.02e-27 110 33 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q5ZUG5 7.15e-27 110 31 3 229 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P37009 7.51e-27 110 29 5 229 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q9WY65 7.97e-27 108 30 4 213 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q325U1 9.44e-27 110 35 3 210 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q3Z5F8 9.73e-27 109 35 3 210 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 9.73e-27 109 35 3 210 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 9.73e-27 109 35 3 210 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63356 9.73e-27 109 35 3 210 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
P45092 1.03e-26 107 30 1 223 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0TLD2 1.07e-26 109 35 3 210 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q5X484 1.09e-26 109 31 3 229 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q7CN92 1.1e-26 110 31 7 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 1.1e-26 110 31 7 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
Q74IV9 1.18e-26 109 30 7 242 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q1WVG9 1.2e-26 109 32 6 223 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q73P93 1.21e-26 111 26 4 221 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P93 2.38e-16 82 27 4 216 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P30750 1.66e-26 109 34 3 210 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
Q043Y8 1.9e-26 109 31 7 242 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q32JQ8 1.93e-26 108 34 3 210 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q8EPK1 2.33e-26 108 33 6 214 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
O34362 2.49e-26 111 30 4 241 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 6.72e-26 109 26 6 270 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q0SML1 2.71e-26 108 31 5 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q83MC5 3.36e-26 108 35 3 210 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 3.36e-26 108 35 3 210 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q02Z10 3.45e-26 109 31 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. cremoris (strain SK11)
Q1J6Q6 3.47e-26 108 30 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 3.47e-26 108 30 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 3.47e-26 108 30 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 3.47e-26 108 30 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q8ZRM9 3.54e-26 108 34 3 210 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57T09 3.76e-26 108 34 3 210 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
P39456 3.86e-26 106 29 6 235 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
O26096 4.62e-26 107 34 5 213 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain ATCC 700392 / 26695)
Q2YQP3 5.02e-26 105 31 3 215 3 BAB1_1388 Putative ABC transporter ATP-binding protein BAB1_1388 Brucella abortus (strain 2308)
Q57CD8 5.02e-26 105 31 3 215 3 BruAb1_1365 Putative ABC transporter ATP-binding protein BruAb1_1365 Brucella abortus biovar 1 (strain 9-941)
Q5XCA4 5.1e-26 108 30 7 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0AAF9 5.53e-26 105 29 1 221 3 artP Arginine transport ATP-binding protein ArtP Shigella flexneri
P0AAF6 5.53e-26 105 29 1 221 1 artP Arginine transport ATP-binding protein ArtP Escherichia coli (strain K12)
P0AAF7 5.53e-26 105 29 1 221 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAF8 5.53e-26 105 29 1 221 3 artP Arginine transport ATP-binding protein ArtP Escherichia coli O157:H7
Q39IE7 5.58e-26 107 35 3 212 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9A502 5.61e-26 107 37 3 218 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P0CZ35 5.7e-26 108 30 7 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 5.7e-26 108 30 7 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 5.7e-26 108 30 7 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q87AL9 6.39e-26 107 34 3 214 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q1WVI7 6.56e-26 107 30 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q5PID0 7.09e-26 107 34 3 210 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z990 7.24e-26 107 34 3 210 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhi
Q8CPN0 8.02e-26 107 29 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
O51587 8.26e-26 107 31 5 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q65F80 8.79e-26 107 32 4 231 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q97WT4 9.27e-26 109 28 3 211 3 SSO2030 Putative ABC transporter ATP-binding protein SSO2030 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97WT4 7.34e-20 92 28 3 225 3 SSO2030 Putative ABC transporter ATP-binding protein SSO2030 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q660M8 9.62e-26 107 31 5 222 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q6D734 9.95e-26 107 29 5 224 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6HG98 9.97e-26 109 33 7 229 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HG98 6.99e-18 86 28 4 226 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q72GX5 1.06e-25 105 31 5 235 3 pstB Phosphate import ATP-binding protein PstB Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q97X60 1.07e-25 109 29 2 212 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q97X60 1.65e-20 94 29 6 245 3 SSO1893 Putative ABC transporter ATP-binding protein SSO1893 Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q724C0 1.24e-25 106 33 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q5HQ70 1.29e-25 107 29 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q18AM3 1.39e-25 106 31 4 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q92AF9 1.6e-25 104 30 5 240 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q49W48 1.78e-25 106 35 3 198 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6LKD4 1.9e-25 106 29 5 223 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q81N53 1.91e-25 108 33 7 229 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
Q81N53 1.32e-18 89 28 4 226 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
Q92EZ6 2.02e-25 106 33 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q0I5E9 2.03e-25 106 32 3 210 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q8FZV2 2.03e-25 103 30 3 215 3 BR1368 Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363 Brucella suis biovar 1 (strain 1330)
Q5WDP1 2.19e-25 106 31 7 272 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q8XXY9 2.28e-25 105 28 5 282 3 nodI Nod factor export ATP-binding protein I Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8RGC8 2.51e-25 106 31 5 220 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q1B677 2.54e-25 105 28 5 229 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q9PF03 2.74e-25 105 33 3 214 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain 9a5c)
Q7N8B9 2.89e-25 105 28 5 235 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9CK97 2.94e-25 105 31 6 254 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q7VV72 2.98e-25 106 32 4 225 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 2.98e-25 106 32 4 225 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 2.98e-25 106 32 4 225 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q1BY14 3.47e-25 105 35 3 212 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 3.47e-25 105 35 3 212 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q897I2 3.85e-25 107 27 3 224 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 7.33e-16 80 30 1 130 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q5FA19 3.85e-25 105 27 5 299 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q73R11 3.89e-25 107 27 3 219 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73R11 4.41e-24 104 29 6 239 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q49WM4 4.6e-25 105 29 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8YA75 4.72e-25 105 32 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q1CR30 4.98e-25 105 34 5 213 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
O85818 6.06e-25 105 30 5 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q5X627 6.82e-25 105 30 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q9K789 6.95e-25 104 35 5 222 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7N8M2 7.04e-25 104 33 3 228 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2SSS4 8.31e-25 104 29 5 242 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q03ZQ0 8.54e-25 105 30 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q50966 8.69e-25 104 29 2 226 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
P50332 8.87e-25 104 30 4 230 3 nodI Nod factor export ATP-binding protein I Neorhizobium galegae
P15031 9.45e-25 102 28 6 269 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
Q5ZWE4 9.53e-25 104 30 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q46Y69 9.59e-25 104 34 3 214 3 metN Methionine import ATP-binding protein MetN Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1AS06 1.16e-24 104 32 4 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q6MU19 1.17e-24 104 28 5 242 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q8Y651 1.26e-24 102 29 3 236 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8H1R4 1.44e-24 102 33 5 207 1 ABCI10 ABC transporter I family member 10 Arabidopsis thaliana
Q8DZJ0 1.56e-24 104 29 5 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 1.56e-24 104 29 5 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 1.56e-24 104 29 5 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q0I3Y9 1.8e-24 104 31 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q4JTG9 2.04e-24 103 30 6 223 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q4L4R9 2.12e-24 103 32 4 220 3 metN Methionine import ATP-binding protein MetN Staphylococcus haemolyticus (strain JCSC1435)
Q72FW5 2.16e-24 103 33 6 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A3CMQ7 2.18e-24 104 30 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
Q9X0Y8 2.33e-24 101 30 6 235 3 pstB Phosphate import ATP-binding protein PstB Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q5WXF0 2.39e-24 103 30 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q830W6 2.49e-24 103 29 6 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q9CP06 2.58e-24 103 31 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q831K6 2.8e-24 103 31 3 210 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q6NJ07 3.16e-24 103 32 3 210 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q93KD4 3.28e-24 100 31 3 215 1 tupC Tungstate uptake system ATP-binding protein TupC Peptoclostridium acidaminophilum
Q5WET8 3.41e-24 101 32 6 228 3 pstB1 Phosphate import ATP-binding protein PstB 1 Shouchella clausii (strain KSM-K16)
O28437 4.08e-24 100 27 3 235 3 AF_1841 Putative ABC transporter ATP-binding protein AF_1841 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9KLQ5 4.09e-24 102 28 6 223 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q03AH0 4.27e-24 103 30 4 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q5M397 4.3e-24 103 30 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYN4 4.39e-24 103 30 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q0BH79 4.45e-24 102 34 3 212 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q03JH1 4.62e-24 103 30 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q97ZT9 4.76e-24 100 30 5 232 3 pstB Phosphate import ATP-binding protein PstB Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q6D5H7 4.95e-24 102 34 7 212 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q38VW6 5.19e-24 102 29 5 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q3KBH4 5.43e-24 102 33 8 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain Pf0-1)
Q65VG9 5.94e-24 102 31 5 240 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5XDS8 6e-24 102 29 5 255 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q9ZJ34 6.45e-24 102 33 5 213 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain J99 / ATCC 700824)
Q9KS33 7.03e-24 102 30 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9X196 7.04e-24 102 31 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q02R79 7.24e-24 102 32 4 227 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q2JLH7 7.87e-24 100 31 5 229 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q55281 7.96e-24 100 31 6 238 3 mntA Manganese transport system ATP-binding protein MntA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9HY19 8.26e-24 102 32 4 227 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q63GR8 9.53e-24 101 30 3 218 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q8Y0X3 9.63e-24 102 33 3 216 3 metN Methionine import ATP-binding protein MetN Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q4QMH4 9.85e-24 101 32 3 210 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
P44785 9.95e-24 101 32 3 210 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q667L9 1.06e-23 101 33 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q734T1 1.08e-23 103 33 7 229 3 BCE_3323 Putative ABC transporter ATP-binding protein BCE_3323 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q734T1 1.3e-18 89 28 4 226 3 BCE_3323 Putative ABC transporter ATP-binding protein BCE_3323 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q48HD9 1.19e-23 99 31 9 245 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q65UE1 1.23e-23 102 31 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7MN25 1.26e-23 101 31 3 210 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q8DUF7 1.3e-23 102 30 7 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q1BWI2 1.35e-23 100 29 3 228 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q8DFC3 1.37e-23 101 31 3 210 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
Q17VE0 1.44e-23 100 32 5 213 3 metN Methionine import ATP-binding protein MetN Helicobacter acinonychis (strain Sheeba)
Q7TNJ2 1.55e-23 103 28 6 234 1 Abca7 ATP-binding cassette sub-family A member 7 Rattus norvegicus
Q7TNJ2 1.08e-13 74 25 3 207 1 Abca7 ATP-binding cassette sub-family A member 7 Rattus norvegicus
Q8P2K6 1.6e-23 101 29 5 255 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q221H2 1.66e-23 99 30 8 243 3 pstB Phosphate import ATP-binding protein PstB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q4ZRT7 1.7e-23 99 30 8 242 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas syringae pv. syringae (strain B728a)
Q880A6 1.7e-23 99 30 8 242 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P45171 1.94e-23 101 29 5 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q832Y6 2.01e-23 101 33 4 210 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_09210
Feature type CDS
Gene ecfA2
Product Energy-coupling factor transporter ATP-binding protein EcfA2
Location 176875 - 177723 (strand: 1)
Length 849 (nucleotides) / 282 (amino acids)

Contig

Accession ZDB_365
Length 192330 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3078
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1122 Inorganic ion transport and metabolism (P)
General function prediction only (R)
PR Energy-coupling factor transporter ATP-binding protein EcfA2

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02006 cobalt/nickel transport system ATP-binding protein ABC transporters -

Protein Sequence

MNHHPQLSVSGLTFRYQDDNILKNLTMDFGAHQVTGIIGANGCGKSTLFMNLSGILKPQDGQVNWRGNPLKYDKKSLLELRQHVVTVFQDPDMQIFYTDVDSDIAFALRNLGVEEDEIKHRTDEALRLVDALAFRDKPVQHLSFGQKKRVAIAGALVMQSDYLLLDEPTAGLDPAGRQQMIDLLARIAAAGKHIVISSHDIDLIYQVCDGIYVMSHGEVCGHGAPESVFLQKEMITAAGLEQPWLVKLHCETGLPLCKTEQALFAQLQQQTTPAAGTHEVMA

Flanking regions ( +/- flanking 50bp)

CAAATGTCCGTCGCACTGAATGTGAAGCTCTATCAGGGAGATTTCCACCTATGAATCATCACCCTCAATTATCGGTCAGCGGTCTCACATTCCGCTATCAGGACGATAATATCCTGAAAAACCTGACAATGGATTTCGGCGCACACCAGGTCACCGGGATTATCGGTGCCAACGGCTGCGGAAAATCCACCCTGTTTATGAACCTGTCCGGTATTCTGAAACCACAGGACGGTCAGGTGAACTGGCGGGGTAATCCGCTGAAATACGACAAAAAATCCCTGCTGGAACTGCGTCAGCATGTGGTGACCGTTTTTCAGGATCCGGATATGCAGATTTTCTACACCGATGTGGACAGTGATATCGCTTTCGCCCTGCGCAATCTCGGGGTGGAAGAGGATGAAATCAAACACCGCACCGATGAGGCACTGCGTCTGGTGGATGCGCTCGCCTTCCGTGACAAACCGGTGCAGCACCTGAGTTTCGGGCAGAAAAAACGCGTGGCGATCGCCGGGGCGCTGGTGATGCAGTCAGATTATCTGCTGCTCGATGAACCGACTGCCGGGCTGGATCCTGCCGGACGTCAGCAGATGATCGACCTGCTGGCCCGTATTGCCGCTGCCGGTAAACACATTGTGATTTCCAGCCATGACATTGATCTGATTTATCAGGTCTGTGATGGTATTTACGTGATGTCGCACGGCGAAGTGTGCGGCCACGGTGCACCGGAGTCCGTTTTCCTGCAAAAAGAGATGATCACCGCCGCCGGGCTGGAACAGCCGTGGCTGGTCAAACTCCACTGCGAAACCGGACTGCCGCTGTGCAAAACTGAACAGGCGCTGTTTGCACAATTGCAGCAGCAGACAACTCCCGCCGCCGGAACACACGAGGTAATGGCATGACATTTTCACTGATGATCCAGGGTACTGCTTCCGATGTCGGAAAAAGTGTA