Homologs in group_378

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18840 FBDBKF_18840 30.5 Morganella morganii S1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
EHELCC_17035 EHELCC_17035 30.5 Morganella morganii S2 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
NLDBIP_18415 NLDBIP_18415 30.5 Morganella morganii S4 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
LHKJJB_09210 LHKJJB_09210 30.5 Morganella morganii S3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
HKOGLL_08760 HKOGLL_08760 30.5 Morganella morganii S5 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
F4V73_RS06470 F4V73_RS06470 28.3 Morganella psychrotolerans - ABC transporter ATP-binding protein
F4V73_RS13755 F4V73_RS13755 31.3 Morganella psychrotolerans - ATP-binding cassette domain-containing protein

Distribution of the homologs in the orthogroup group_378

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_378

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A3DJK5 3.8e-40 142 31 3 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q2RFS8 4.67e-40 142 34 3 249 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q832R5 5.16e-40 148 33 2 249 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 1.71e-20 93 25 4 242 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q6LQ00 1.71e-39 146 33 5 250 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 5.48e-17 83 22 4 258 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q8TIX0 3.7e-39 141 31 1 230 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q7MFH3 8.17e-39 145 31 4 251 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 8.85e-21 94 25 3 252 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q04EY5 1.14e-38 139 30 3 250 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8D3Z9 1.26e-38 144 31 4 251 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 2.11e-20 93 25 3 252 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8PSR0 9.94e-38 142 35 3 226 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 3.03e-28 115 29 5 256 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8ES39 1.9e-37 140 35 0 217 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 1.22e-23 102 27 5 247 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q045Z8 7.12e-37 134 31 4 259 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q5M243 9.28e-37 134 34 3 226 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ3 9.28e-37 134 34 3 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain CNRZ 1066)
Q87G35 1.25e-36 139 31 4 246 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 5.36e-18 86 23 3 252 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q03I82 1.33e-36 133 34 3 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q0SWH9 1.33e-36 133 30 4 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q0TUN8 2.06e-36 133 30 4 254 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q035B2 2.16e-36 133 31 2 251 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q7NAQ6 2.57e-36 132 29 2 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q6YRJ4 2.69e-36 138 31 2 221 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q6YRJ4 8.32e-25 105 25 3 253 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q8YQ88 4.05e-36 132 32 3 247 3 alr3946 Putative ABC transporter ATP-binding protein alr3946 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8PYH5 1.85e-35 131 32 1 230 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8TQ05 2.07e-35 136 34 2 234 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 2.46e-29 119 31 3 230 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q97KZ3 2.52e-35 129 30 3 231 3 CA_C0773 Putative ABC transporter ATP-binding protein CA_C0773 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q0I3Y9 5.43e-35 131 33 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q38UT9 6.31e-35 129 32 2 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q5FM63 6.98e-35 129 31 3 227 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q5L3R0 7.38e-35 129 30 2 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
Q81J16 1.38e-34 128 32 3 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A0PXX8 1.73e-34 128 30 6 257 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium novyi (strain NT)
Q74L62 1.97e-34 128 30 4 254 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q1WSB8 2.06e-34 127 30 4 252 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
Q8XNY7 2.22e-34 127 29 4 254 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q8TYV9 2.42e-34 127 35 5 242 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q88ZZ2 2.76e-34 132 31 2 247 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 4.21e-17 83 24 3 253 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6HPN0 3.79e-34 127 32 3 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 3.79e-34 127 32 3 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 3.79e-34 127 32 3 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q73F67 5.26e-34 126 32 3 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8PY27 7.79e-34 126 31 5 250 3 MM_1037 Putative ABC transporter ATP-binding protein MM_1037 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8TI16 1.02e-33 125 31 4 249 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q63H62 1.82e-33 125 32 3 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q67JX4 2.04e-33 125 35 3 219 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A3CRB9 2.29e-33 125 29 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q04BY7 2.53e-33 125 28 3 254 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBJ0 3.95e-33 124 28 3 254 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q88XV2 4.38e-33 124 31 3 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6KHL1 4.38e-33 124 28 3 254 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q81PZ8 5.63e-33 129 32 1 227 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 4.44e-21 95 25 3 252 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q58488 5.82e-33 124 29 2 226 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O27739 5.98e-33 124 31 3 232 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O85818 6.73e-33 125 33 6 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q0T5R2 7.93e-33 125 36 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
Q890R3 8.69e-33 124 31 6 258 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium tetani (strain Massachusetts / E88)
Q6XYZ4 1.14e-32 123 28 2 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Spiroplasma kunkelii
P45171 1.36e-32 125 33 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8XK20 1.94e-32 127 26 5 251 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 1.49e-19 90 26 4 223 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8CRI6 2.02e-32 122 28 2 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM27 2.02e-32 122 28 2 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9Z9J3 2.02e-32 122 33 5 252 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q38UU0 2.05e-32 122 32 6 261 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q32EY4 2.06e-32 124 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
Q8DMX9 2.57e-32 122 29 5 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 2.57e-32 122 29 5 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 2.57e-32 122 29 5 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9CP06 2.59e-32 124 32 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q6HI76 2.72e-32 127 32 1 227 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 2.89e-21 95 25 3 252 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q3Z2Z3 3.29e-32 124 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 3.29e-32 124 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q50294 4.18e-32 121 29 1 206 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P69877 4.93e-32 124 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 4.93e-32 124 35 4 216 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 4.93e-32 124 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 4.93e-32 124 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 4.93e-32 124 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
Q1RD28 5.09e-32 124 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 5.09e-32 124 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
Q74I62 6.29e-32 126 28 5 253 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q74I62 5.46e-19 89 23 4 242 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8DWR3 6.98e-32 121 32 2 204 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 6.98e-32 121 32 2 204 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 6.98e-32 121 32 2 204 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q6D4E2 7.3e-32 123 34 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q03PY5 8.35e-32 120 32 5 254 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q4QK57 9.63e-32 122 32 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q65P77 1.02e-31 120 30 3 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8R9L8 1.25e-31 125 29 1 247 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R9L8 1.53e-21 96 28 5 229 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
P40735 1.77e-31 120 30 3 226 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
Q8G838 2.89e-31 124 31 4 267 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 1.71e-26 111 33 3 219 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
P40790 3.09e-31 121 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 3.09e-31 121 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
Q98QH5 3.11e-31 119 26 2 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8Z7H7 3.19e-31 121 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q5PMK1 3.39e-31 121 35 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
O68106 4.16e-31 119 34 3 250 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8TTN2 4.51e-31 122 30 2 242 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8VNL9 6.89e-31 118 30 6 254 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
A0ALT7 7.11e-31 118 28 2 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q7MKU3 8.29e-31 120 32 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 8.29e-31 120 32 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q81CT8 8.74e-31 122 30 1 224 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 9.15e-20 91 24 3 252 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2FRT7 1.05e-30 120 30 3 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q74L61 1.1e-30 118 30 4 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8DQY5 1.16e-30 122 30 2 247 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 4.09e-15 77 25 5 254 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q65UE1 1.33e-30 120 31 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q4A5A5 1.34e-30 117 26 3 250 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q9KS33 1.42e-30 120 31 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q737I0 1.85e-30 122 28 1 245 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 1.6e-19 90 24 3 252 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8R7Y5 2.22e-30 117 27 4 253 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q92XW1 2.42e-30 118 37 5 216 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q4L885 2.45e-30 117 27 2 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
Q97SA3 3.05e-30 121 30 2 247 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97SA3 9.3e-16 79 25 4 253 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8TQW9 3.41e-30 120 31 0 199 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 6.07e-25 106 30 2 228 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
O34362 3.88e-30 120 34 3 221 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 9.6e-21 94 29 5 235 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q045Z7 4.05e-30 117 32 2 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q9CIS9 4.26e-30 116 30 3 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q8KFD6 4.84e-30 116 32 5 256 3 CT0391 Putative ABC transporter ATP-binding protein CT0391 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
O57872 4.92e-30 115 27 3 237 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q73KT5 8.01e-30 115 29 2 233 3 TDE_2132 Putative ABC transporter ATP-binding protein TDE_2132 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q5HM28 9.01e-30 115 29 3 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CRI7 9.2e-30 115 29 3 213 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q97EK9 1.13e-29 115 28 7 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8DRR9 1.17e-29 115 27 3 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93D97 1.18e-29 119 28 2 248 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93D97 3.69e-18 86 25 4 242 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8TK65 1.25e-29 118 31 5 263 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8XHV3 1.26e-29 115 30 4 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain 13 / Type A)
Q0TMS8 1.26e-29 115 30 4 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8Z0H0 1.33e-29 116 36 4 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q2LY16 1.82e-29 115 31 2 225 3 cbiO Cobalt import ATP-binding protein CbiO Syntrophus aciditrophicus (strain SB)
Q3A9G5 2.04e-29 115 31 4 232 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q3ABN1 2.22e-29 114 30 2 242 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A3CVD3 2.61e-29 114 27 2 248 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q8PY26 2.77e-29 114 30 3 232 3 MM_1038 Putative ABC transporter ATP-binding protein MM_1038 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q6F1W5 2.82e-29 117 27 2 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q87PH3 2.83e-29 116 31 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q55740 2.83e-29 114 33 4 243 3 sll0385 Putative ABC transporter ATP-binding protein sll0385 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8PZN0 2.96e-29 117 31 5 263 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q890D1 3.03e-29 113 36 6 206 2 larO Nickel import ATP-binding protein LarO Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q6LX68 3.15e-29 114 27 2 226 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q032H4 3.25e-29 114 30 3 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 3.25e-29 114 30 3 226 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
Q74DN5 3.88e-29 113 31 3 238 3 GSU1281 Putative ABC transporter ATP-binding protein GSU1281 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q839D5 4.05e-29 114 29 3 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8U4L3 4.1e-29 113 29 1 204 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q2SRI1 4.64e-29 116 28 2 250 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8DMY0 5.55e-29 113 29 4 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV8 5.55e-29 113 29 4 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9PPV1 6.93e-29 113 26 3 250 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q8DIA0 7.51e-29 114 35 7 236 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8Y454 7.69e-29 113 27 2 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P47425 7.86e-29 113 28 1 210 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q7VNG4 8.2e-29 115 29 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q71WH7 9.59e-29 113 27 2 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
Q50801 1.1e-28 112 30 3 222 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q72D73 1.12e-28 112 36 4 214 3 DVU_1056 Putative ABC transporter ATP-binding protein DVU_1056 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q97N51 1.17e-28 112 29 4 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q927N8 1.29e-28 112 27 2 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8ETV7 1.36e-28 112 28 2 221 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9WY65 1.57e-28 112 33 8 231 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q92VJ2 1.69e-28 114 36 5 216 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q8RHK9 1.98e-28 112 31 6 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q2FNX9 2.11e-28 112 28 3 253 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q93DX8 2.13e-28 111 36 6 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q897I2 2.2e-28 115 27 2 234 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 4.54e-07 53 22 1 127 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
P56344 3e-28 110 35 4 212 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q032H3 3.53e-28 111 30 5 233 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI02 3.96e-28 111 30 5 233 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q03ZL6 4.22e-28 111 30 4 252 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q2NHA1 4.3e-28 111 27 2 249 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q03I83 5.47e-28 110 29 3 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M244 5.47e-28 110 29 3 231 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ4 5.47e-28 110 29 3 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain CNRZ 1066)
Q97JB8 5.53e-28 110 27 4 231 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q720M2 8e-28 110 31 4 227 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
P0CZ27 8.76e-28 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 8.76e-28 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q6D201 9.64e-28 111 33 5 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6MSQ1 1.01e-27 112 27 2 250 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q748K0 1.1e-27 110 30 4 223 3 GSU3001 Putative ABC transporter ATP-binding protein GSU3001 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A2RH10 1.14e-27 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J450 1.14e-27 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC9 1.14e-27 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJD0 1.14e-27 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J983 1.14e-27 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMM8 1.14e-27 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B6 1.14e-27 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XI2 1.14e-27 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M1
Q48QM3 1.19e-27 110 27 4 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q8NUH8 1.23e-27 114 27 1 243 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q8NUH8 4.89e-14 74 21 3 241 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q6G5Z1 1.23e-27 114 27 1 243 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q6G5Z1 4.89e-14 74 21 3 241 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q8Y7R4 1.32e-27 109 31 4 227 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q6LR20 1.38e-27 111 31 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q04BY6 1.38e-27 110 32 4 231 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBI9 1.38e-27 110 32 4 231 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q88XV1 1.47e-27 110 30 3 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8TI15 1.47e-27 110 30 4 232 3 MA_4342 Putative ABC transporter ATP-binding protein MA_4342 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8PUE7 1.51e-27 113 31 0 203 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 9.28e-24 102 28 2 228 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q6GDC0 1.6e-27 113 27 1 243 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q6GDC0 5.71e-13 71 21 4 242 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q03EE4 1.98e-27 109 27 4 242 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q1J982 2.09e-27 109 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P31134 2.57e-27 111 31 5 229 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q6F0V4 2.59e-27 110 30 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q0SML1 3e-27 110 26 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q48QM2 3.38e-27 108 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 3.38e-27 108 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 3.38e-27 108 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q8F6Z1 3.41e-27 110 34 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 3.41e-27 110 34 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8DY60 3.42e-27 112 27 3 252 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY60 7.49e-09 59 23 6 242 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q5HCL3 3.63e-27 112 27 1 243 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q5HCL3 6.79e-14 74 21 3 241 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
P0C0E9 3.72e-27 108 31 2 201 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 3.72e-27 108 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 3.72e-27 108 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 3.72e-27 108 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 3.72e-27 108 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 3.72e-27 108 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 3.72e-27 108 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 3.72e-27 108 31 2 201 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q81N53 4e-27 112 30 2 225 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
Q81N53 8.98e-22 97 28 1 222 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
Q9V1Q4 4.12e-27 108 25 2 245 3 PYRAB03730 Putative ABC transporter ATP-binding protein PYRAB03730 Pyrococcus abyssi (strain GE5 / Orsay)
Q49ZE0 4.61e-27 108 31 2 208 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O31339 4.66e-27 110 34 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6YR39 5.17e-27 108 29 4 228 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q99QV7 5.31e-27 112 26 1 243 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q99QV7 6.86e-14 74 21 3 241 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A342 5.31e-27 112 26 1 243 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q7A342 6.86e-14 74 21 3 241 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
O51587 5.74e-27 109 26 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q9MUN1 6.14e-27 109 33 4 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q660M8 9.92e-27 108 26 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q839D4 9.99e-27 107 29 3 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q7N6Z2 1.11e-26 109 34 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q87DT9 1.16e-26 108 35 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q7N8M2 1.18e-26 108 32 4 231 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8E3S6 1.31e-26 110 27 3 252 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8E3S6 3.85e-09 60 23 6 242 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q73R11 1.38e-26 110 26 1 235 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73R11 6.6e-19 88 28 2 196 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q7WGW1 1.68e-26 108 37 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q88AS5 1.74e-26 108 34 6 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q49ZD9 1.84e-26 107 27 3 235 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q65VG9 2.1e-26 108 30 4 236 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P63354 2.22e-26 108 35 5 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 2.22e-26 108 35 5 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q7NIW1 2.22e-26 108 35 4 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
P94360 2.29e-26 108 29 6 250 1 msmX Oligosaccharides import ATP-binding protein MsmX Bacillus subtilis (strain 168)
Q609Q1 2.54e-26 107 36 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q63GR8 2.86e-26 107 29 5 238 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
O26236 2.97e-26 106 29 3 221 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9V2E4 3.02e-26 105 26 2 240 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q5YZY9 3.04e-26 107 36 5 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q58967 3.04e-26 106 29 4 206 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q927N9 3.09e-26 106 27 4 235 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9I6L0 3.1e-26 107 34 6 219 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O59479 3.52e-26 106 26 4 242 3 PH1815 Putative ABC transporter ATP-binding protein PH1815 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8ETV6 3.56e-26 106 31 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q04FM1 3.85e-26 106 31 6 223 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A0ALT6 3.96e-26 106 27 4 235 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q6HG98 4.26e-26 109 30 2 225 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HG98 1.8e-22 99 29 1 222 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q7VZE5 4.54e-26 107 36 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q5PFQ7 5.38e-26 107 34 4 227 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9V2C0 5.61e-26 107 29 4 229 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus abyssi (strain GE5 / Orsay)
Q8RD07 5.75e-26 104 28 6 238 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7W9U5 5.93e-26 107 36 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q71WH8 5.95e-26 105 27 4 235 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q8Z8W8 6.2e-26 107 34 4 227 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
D5AQY6 6.35e-26 105 34 3 237 1 nikO Nickel import ATP-binding protein NikO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q92CK1 6.38e-26 105 31 4 227 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q0I5E9 6.51e-26 106 30 4 234 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q5L3Q9 6.99e-26 105 29 3 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Geobacillus kaustophilus (strain HTA426)
Q5PID0 7.68e-26 106 31 6 267 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8TIW9 7.71e-26 105 29 5 234 3 MA_4021 Putative ABC transporter ATP-binding protein MA_4021 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8Y455 9.01e-26 105 27 4 235 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q57SD6 1.01e-25 106 35 4 227 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
Q8UH62 1.06e-25 106 34 6 224 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4A5A4 1.07e-25 105 26 3 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis synoviae (strain 53)
Q81IN8 1.09e-25 106 28 5 238 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6D1C4 1.22e-25 105 30 5 247 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q73EL7 1.29e-25 105 28 5 238 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8YCG3 1.34e-25 106 33 4 213 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q578K3 1.52e-25 105 33 4 213 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q2YKX3 1.52e-25 105 33 4 213 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
Q32JQ8 1.56e-25 105 33 4 229 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q81GU1 1.59e-25 105 34 6 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6D5H7 1.65e-25 105 32 6 239 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8YA75 1.65e-25 105 30 3 227 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
O57896 1.69e-25 105 28 5 233 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8Z990 1.92e-25 105 31 6 267 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhi
Q82WT5 1.98e-25 105 34 6 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8DRS0 2e-25 104 27 4 248 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q92EZ6 2.07e-25 105 31 3 227 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P96063 2.11e-25 105 34 4 227 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P47546 2.25e-25 103 28 9 262 3 MG304 Putative ABC transporter ATP-binding protein MG304 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8EUF1 2.33e-25 104 24 4 253 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Malacoplasma penetrans (strain HF-2)
Q6GEL3 2.35e-25 103 26 4 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
Q724C0 2.49e-25 105 30 3 227 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q3Z5F8 2.61e-25 105 33 4 229 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 2.61e-25 105 33 4 229 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 2.61e-25 105 33 4 229 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63356 2.61e-25 105 33 4 229 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
Q325U1 2.63e-25 105 33 4 229 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q0TLD2 2.71e-25 105 33 4 229 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8U6M1 2.72e-25 105 33 4 213 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q57T09 3.1e-25 105 31 6 267 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
Q98QH4 3.19e-25 104 28 4 249 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q1WSB9 3.3e-25 103 28 3 217 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q6HP89 3.48e-25 104 28 5 238 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q734T1 3.55e-25 107 30 2 226 3 BCE_3323 Putative ABC transporter ATP-binding protein BCE_3323 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q734T1 2.71e-22 98 29 1 222 3 BCE_3323 Putative ABC transporter ATP-binding protein BCE_3323 Bacillus cereus (strain ATCC 10987 / NRS 248)
A1TXH7 3.73e-25 105 32 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A3DJK3 3.85e-25 103 30 7 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8FVV5 4.01e-25 104 33 4 213 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella suis biovar 1 (strain 1330)
Q9CIS8 4.03e-25 103 29 5 233 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q9G4F5 4.13e-25 104 36 6 216 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q88CL2 4.28e-25 104 32 5 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q92WJ0 4.48e-25 104 33 4 213 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q9TKX3 4.49e-25 104 34 5 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
P30750 4.63e-25 104 33 4 229 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
Q7CHF8 4.63e-25 104 30 5 258 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis
Q1C970 4.63e-25 104 30 5 258 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Antiqua)
Q66CQ3 4.63e-25 104 30 5 258 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CG91 4.63e-25 104 30 5 258 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZRM9 4.67e-25 104 31 6 267 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8NVB5 5.14e-25 102 26 4 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 5.14e-25 102 26 4 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
Q81ZF5 5.36e-25 104 28 5 235 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q8DG84 5.38e-25 103 35 4 203 3 tll2439 Putative ABC transporter ATP-binding protein tll2439 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q7A470 5.59e-25 102 25 2 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 5.59e-25 102 25 2 226 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YYM4 6.01e-25 102 26 4 238 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9RKC6 6.13e-25 102 31 2 217 3 SCO3161 Putative ABC transporter ATP-binding protein SCO3161 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q82HA2 6.38e-25 102 31 2 223 3 SAV_3608 Putative ABC transporter ATP-binding protein SAV_3608 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q89UD2 6.45e-25 103 35 5 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8PVG9 6.62e-25 106 31 5 228 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PVG9 8.04e-21 94 29 4 224 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P74548 7.15e-25 104 33 5 220 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q73F66 7.18e-25 103 28 6 237 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q0KDG3 7.37e-25 103 34 6 235 3 metN Methionine import ATP-binding protein MetN Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q4L884 7.84e-25 102 26 4 211 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus haemolyticus (strain JCSC1435)
Q2NIT5 7.86e-25 102 27 4 228 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q62K82 7.89e-25 103 35 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
P0A9S0 8.63e-25 101 32 5 221 3 ftsE Cell division ATP-binding protein FtsE Shigella flexneri
P0A9R7 8.63e-25 101 32 5 221 1 ftsE Cell division ATP-binding protein FtsE Escherichia coli (strain K12)
P0A9R8 8.63e-25 101 32 5 221 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9R9 8.63e-25 101 32 5 221 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O157:H7
Q63TY1 8.91e-25 103 35 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q04EY4 9.53e-25 102 28 2 212 3 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q9PDN2 9.57e-25 103 35 5 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q7VM95 9.61e-25 103 29 5 238 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q2SJY7 1.1e-24 103 31 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
P14788 1.17e-24 103 33 4 213 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7NX01 1.32e-24 103 37 6 216 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q667L9 1.46e-24 103 33 6 235 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q65T42 1.47e-24 103 33 6 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q6LKD4 1.94e-24 102 33 4 211 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q81J15 2.13e-24 101 28 6 237 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8ELA5 2.16e-24 102 29 4 237 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q83MC5 2.17e-24 102 33 4 229 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 2.17e-24 102 33 4 229 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q5E586 2.2e-24 103 30 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q2SSS4 2.28e-24 102 29 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q63E84 2.29e-24 102 30 4 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 2.29e-24 102 30 4 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 2.29e-24 102 30 4 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q035B3 2.4e-24 101 30 6 256 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q9CK97 2.44e-24 102 28 4 247 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q57S53 2.5e-24 102 33 7 239 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q0AUL1 2.54e-24 101 30 3 226 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q81IZ6 2.64e-24 102 29 4 234 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q7N0N3 2.75e-24 99 32 11 225 3 plu3849 Putative ABC transporter ATP-binding protein plu3849 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6HLQ9 2.84e-24 102 30 4 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q5HDY6 3.11e-24 100 25 2 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 3.11e-24 100 25 2 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 3.11e-24 100 25 2 222 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q6MU19 3.26e-24 102 28 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q8Z8R5 3.51e-24 102 33 7 239 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q9KL04 4.1e-24 102 30 5 224 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1WVI7 4.66e-24 102 30 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q6LK87 4.93e-24 102 29 6 240 3 malK Maltose/maltodextrin import ATP-binding protein MalK Photobacterium profundum (strain SS9)
Q6NBT1 5.77e-24 101 34 5 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A0PXX7 5.91e-24 100 25 4 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium novyi (strain NT)
Q5FM62 6.08e-24 100 28 2 211 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A1SWH9 6.08e-24 102 30 5 228 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q7A088 6.38e-24 100 27 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MW2)
Q6G7A0 6.38e-24 100 27 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MSSA476)
Q7A471 6.38e-24 100 27 4 232 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain N315)
Q99S48 6.38e-24 100 27 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY7 6.38e-24 100 27 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain COL)
Q2FW35 6.38e-24 100 27 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER8 6.38e-24 100 27 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain USA300)
Q8UA73 6.49e-24 101 32 5 215 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5PCG9 6.96e-24 101 33 7 239 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q81TH8 6.99e-24 100 30 4 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
Q18CI9 7.33e-24 100 30 5 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridioides difficile (strain 630)
Q2YYM5 7.53e-24 100 27 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6F9A8 7.79e-24 101 32 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q2YKR8 8.4e-24 101 32 4 217 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella abortus (strain 2308)
A0LUE6 8.43e-24 101 33 4 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q6HPM9 8.69e-24 100 27 6 237 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 8.69e-24 100 27 6 237 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
Q30V33 8.75e-24 101 32 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8PGE8 8.79e-24 100 34 6 237 3 metN Methionine import ATP-binding protein MetN Xanthomonas axonopodis pv. citri (strain 306)
A0R8K9 9.15e-24 100 27 6 237 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q45460 9.21e-24 101 28 6 231 2 opuBA Choline transport ATP-binding protein OpuBA Bacillus subtilis (strain 168)
Q03PY6 9.24e-24 100 29 4 230 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q8FW07 1.03e-23 100 32 4 217 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella suis biovar 1 (strain 1330)
Q578E9 1.03e-23 100 32 4 217 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella abortus biovar 1 (strain 9-941)
Q8ZR89 1.15e-23 100 33 7 239 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8YCB1 1.19e-23 100 32 4 217 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q9KLQ5 1.22e-23 100 31 4 213 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8R7Y4 1.28e-23 99 27 5 237 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q4A8A1 1.37e-23 99 26 3 245 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain 7448)
Q1CFH7 1.39e-23 100 32 6 248 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 1.39e-23 100 32 6 248 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 1.39e-23 100 32 6 248 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q6NJ07 1.4e-23 100 30 6 235 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q2K8C8 1.4e-23 100 33 4 213 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8TSC8 1.47e-23 102 30 6 229 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TSC8 3.17e-21 95 28 3 235 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q6GEL4 1.49e-23 99 26 4 233 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MRSA252)
Q81GC1 1.51e-23 100 30 4 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5JEB0 1.53e-23 100 29 4 211 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9HMZ4 1.59e-23 98 32 5 238 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q88RL5 1.67e-23 100 31 5 235 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q63H61 1.85e-23 99 27 5 236 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ZK / E33L)
Q2P7S3 1.97e-23 100 33 5 234 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q4AA74 2.05e-23 99 26 3 245 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q601T6 2.05e-23 99 26 3 245 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain 232)
Q8U4K3 2.1e-23 100 27 4 230 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q5FL41 2.21e-23 100 31 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q81VM2 2.31e-23 100 28 4 234 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q04BG2 2.38e-23 100 30 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q668K6 2.44e-23 100 33 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8RHL0 2.46e-23 98 27 4 230 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5PDU4 2.53e-23 98 33 6 233 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q5M397 2.61e-23 100 28 4 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYN4 2.69e-23 100 28 4 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q8Z5N5 2.77e-23 98 33 6 233 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhi
Q03JH1 2.8e-23 100 28 4 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q1WVG9 2.8e-23 99 27 4 239 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q5H503 3.09e-23 99 33 5 234 3 metN Methionine import ATP-binding protein MetN Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q6A6X6 3.12e-23 99 34 5 216 3 metN Methionine import ATP-binding protein MetN Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q05596 3.24e-23 98 33 6 233 1 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8D0W8 3.88e-23 99 33 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
Q8X6U5 4.23e-23 99 31 6 230 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli O157:H7
Q9YGA6 4.58e-23 99 30 6 226 1 malK Trehalose/maltose import ATP-binding protein MalK Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q8DWR4 4.69e-23 97 26 4 258 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 4.69e-23 97 26 4 258 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 4.69e-23 97 26 4 258 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q3BNZ3 4.98e-23 99 33 5 236 3 metN Methionine import ATP-binding protein MetN Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q9K876 5.09e-23 99 34 8 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q72FW5 5.41e-23 99 32 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q63H29 5.43e-23 99 28 4 234 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q66FU4 5.58e-23 99 30 7 253 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q0AGF4 5.64e-23 99 31 4 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8E8K8 5.71e-23 99 31 5 216 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q73F11 5.95e-23 99 28 4 234 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q31VH5 5.98e-23 99 31 6 230 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Shigella boydii serotype 4 (strain Sb227)
Q8EPK1 6.11e-23 98 28 4 234 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8P4S7 6.36e-23 98 32 5 234 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 6.36e-23 98 32 5 234 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q1GB17 6.43e-23 99 30 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q18CJ0 6.72e-23 97 29 4 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
P10907 6.82e-23 99 31 6 230 1 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli (strain K12)
Q3YW77 6.89e-23 99 31 6 230 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Shigella sonnei (strain Ss046)
A3CRB8 7.72e-23 97 28 4 258 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
O34992 7.95e-23 99 27 6 231 1 opuCA Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA Bacillus subtilis (strain 168)
Q9A7X1 8.07e-23 98 36 5 217 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1CNC6 8.11e-23 98 30 7 253 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pestis bv. Antiqua (strain Nepal516)
Q74R28 8.11e-23 98 30 7 253 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pestis
Q1CBH2 8.11e-23 98 30 7 253 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pestis bv. Antiqua (strain Antiqua)
Q8RGC8 8.21e-23 99 30 5 225 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q7NWX3 8.75e-23 98 34 5 211 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P54537 9.09e-23 96 27 5 233 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q8KF76 9.69e-23 96 33 5 213 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8ELR4 1.02e-22 98 31 4 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5ZWE4 1.05e-22 98 30 4 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P9WQM1 1.18e-22 98 35 4 212 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 1.18e-22 98 35 4 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 1.18e-22 98 35 4 212 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q890R2 1.22e-22 96 25 4 256 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium tetani (strain Massachusetts / E88)
A3DDF6 1.24e-22 98 28 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q74K65 1.25e-22 98 31 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q5L222 1.26e-22 98 27 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q87GB5 1.37e-22 98 29 5 224 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6KHL2 1.48e-22 97 27 3 226 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q830W6 1.59e-22 97 30 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q9KUI0 1.6e-22 98 34 5 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9A502 1.64e-22 97 32 4 216 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2KBP5 1.72e-22 95 32 5 197 1 bioM Biotin transport ATP-binding protein BioM Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8FV85 1.91e-22 97 31 5 237 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 1.91e-22 97 31 5 237 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 1.91e-22 97 31 5 237 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 1.91e-22 97 31 5 237 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q03PF2 1.93e-22 97 31 4 216 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q97KS6 1.96e-22 97 29 6 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q47T99 1.96e-22 97 30 6 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermobifida fusca (strain YX)
Q32EX7 2.14e-22 95 30 4 214 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q1QE80 2.17e-22 98 30 5 229 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1MQ44 2.29e-22 97 31 4 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q7NNW9 2.29e-22 95 32 4 225 3 gll0289 Putative ABC transporter ATP-binding protein gll0289 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q6D3Q6 2.81e-22 97 31 4 235 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q98K23 2.84e-22 97 33 5 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q88ZJ6 3.08e-22 97 31 4 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q38VW6 3.14e-22 97 29 4 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
P17328 3.15e-22 97 31 3 210 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75957 3.35e-22 94 30 4 214 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
O32151 3.45e-22 97 28 5 232 3 yurJ Uncharacterized ABC transporter ATP-binding protein YurJ Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS06465
Feature type CDS
Gene -
Product ATP-binding cassette domain-containing protein
Location 1348226 - 1348984 (strand: -1)
Length 759 (nucleotides) / 252 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_378
Orthogroup size 8
N. genomes 6

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1122 Inorganic ion transport and metabolism (P)
General function prediction only (R)
PR Energy-coupling factor transporter ATP-binding protein EcfA2

Protein Sequence

MLHLESLSYAWPGAGQNCITQLSLTIAPGEWVALAGDNGAGKSTLLRLAAGLLRPDEGRALFRGQELTDYTAAQRADHIGVLFQEAEHQIFHSTVYDEVAFGLRRRKLPAAEIKRRTLQAITDCGLDDVIQIHPLDLHAGQRRMVAVAGLSAAAPSFLLLDEPGRDFDAFWLTRFESWLALQQAAGTAILAISHDFDFIARHFPRVVHLDAGGLIADGSPQDVLYHPQLQSPGVLPAPTLHSLRRALSPKTE

Flanking regions ( +/- flanking 50bp)

TGCCGTTCCGCAGGATGATACGGCACTGATCGCTGCCTTTAAGGAAAATCATGTTACACCTTGAGAGTCTGAGCTATGCCTGGCCGGGCGCCGGACAAAATTGTATCACTCAACTGTCATTGACGATCGCCCCGGGGGAATGGGTGGCGCTGGCAGGGGATAATGGGGCGGGGAAATCCACATTACTGCGTCTTGCTGCCGGATTACTGCGCCCGGATGAAGGTCGCGCGTTATTCCGCGGACAGGAACTGACAGATTACACCGCTGCACAGCGCGCAGACCATATCGGTGTATTGTTTCAGGAAGCAGAGCATCAGATTTTTCACAGCACAGTCTATGATGAGGTGGCTTTCGGGTTACGGCGGCGGAAATTACCGGCAGCAGAGATAAAACGGCGGACATTACAGGCAATAACAGATTGCGGGCTGGATGATGTTATCCAGATTCATCCTCTGGATTTGCATGCCGGTCAGCGCCGGATGGTGGCGGTTGCCGGGCTGAGTGCGGCGGCACCCTCATTTTTATTACTGGATGAGCCGGGGCGGGATTTTGATGCGTTCTGGCTTACGCGTTTTGAATCCTGGCTGGCATTACAGCAGGCCGCCGGAACCGCTATCCTGGCTATCAGCCATGACTTTGATTTTATTGCCCGGCACTTTCCGCGCGTAGTGCATCTTGATGCCGGCGGGCTGATTGCAGACGGCTCCCCGCAGGATGTACTTTATCATCCGCAATTACAATCCCCCGGCGTATTACCGGCACCGACGCTGCATTCATTACGCAGAGCATTGTCACCAAAAACAGAATAATATGCCCTTATGCATTCAAACTGCCGGTTTGTTGGCTGTATCTCGAATGA