Homologs in group_378

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18840 FBDBKF_18840 90.1 Morganella morganii S1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
EHELCC_17035 EHELCC_17035 90.1 Morganella morganii S2 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
NLDBIP_18415 NLDBIP_18415 90.1 Morganella morganii S4 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
LHKJJB_09210 LHKJJB_09210 90.1 Morganella morganii S3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
HKOGLL_08760 HKOGLL_08760 90.1 Morganella morganii S5 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2
F4V73_RS06465 F4V73_RS06465 31.3 Morganella psychrotolerans - ATP-binding cassette domain-containing protein
F4V73_RS06470 F4V73_RS06470 30.7 Morganella psychrotolerans - ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_378

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_378

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q05596 2.71e-128 368 66 0 263 1 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5N5 3.03e-128 368 66 0 263 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella typhi
Q5PDU4 3.2e-128 368 66 0 263 3 cbiO Cobalt import ATP-binding protein CbiO Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Y7R4 4.48e-100 296 53 1 267 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92CK1 1.24e-99 295 54 1 260 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q720M2 3.27e-99 294 52 1 267 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q0TUN8 6.26e-70 220 45 2 241 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8XNY7 8.38e-70 220 44 2 241 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q58488 1.43e-69 219 45 1 239 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q0SWH9 2.18e-69 219 44 2 241 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q50801 8.81e-64 204 43 2 242 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
A3CVD3 4.44e-62 200 45 3 244 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q8TTN2 4.76e-62 205 41 1 252 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q6LX68 8.76e-62 199 39 1 243 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q8TK65 9.95e-61 202 39 2 271 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
O26236 1.21e-60 196 40 2 249 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q2NHA1 2.1e-59 193 41 1 243 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q8KFD6 4.71e-59 192 42 1 228 3 CT0391 Putative ABC transporter ATP-binding protein CT0391 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
O27739 3.32e-58 191 39 1 243 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8PZN0 4.04e-58 195 39 1 246 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8YQ88 4.34e-58 189 39 0 231 3 alr3946 Putative ABC transporter ATP-binding protein alr3946 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q2FNX9 6.41e-58 189 40 3 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q2FRT7 4.34e-57 191 39 1 248 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
O68106 7.09e-56 184 38 3 278 1 cbiO Cobalt import ATP-binding protein CbiO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q3ABN1 1.67e-55 183 40 3 241 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
O54187 3.98e-53 177 38 3 249 3 SCO5958 Putative ABC transporter ATP-binding protein SCO5958 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8TIX0 1.99e-52 177 38 3 247 3 MA_4020 Putative ABC transporter ATP-binding protein MA_4020 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q51719 9.3e-51 171 38 2 239 3 None Putative ABC transporter ATP-binding protein in cobA 5'region Propionibacterium freudenreichii subsp. shermanii
Q8R7Y5 1.51e-50 171 38 4 260 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8PYH5 1.65e-50 172 36 3 247 3 MM_0887 Putative ABC transporter ATP-binding protein MM_0887 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q73KT5 2.68e-48 164 37 2 241 3 TDE_2132 Putative ABC transporter ATP-binding protein TDE_2132 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q748K0 5.8e-48 164 36 4 260 3 GSU3001 Putative ABC transporter ATP-binding protein GSU3001 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
O57872 1.5e-47 162 36 5 255 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q1WSB8 2.92e-47 162 37 4 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ligilactobacillus salivarius (strain UCC118)
Q74DN5 7.08e-47 160 37 5 253 3 GSU1281 Putative ABC transporter ATP-binding protein GSU1281 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
O29527 7.51e-47 161 38 0 213 3 AF_0731 Putative ABC transporter ATP-binding protein AF_0731 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q839D5 9.15e-46 158 37 4 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q65P77 2.78e-45 157 37 5 263 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8U4L3 3.86e-45 156 37 6 260 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q18CI9 5.77e-45 156 36 4 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridioides difficile (strain 630)
Q8U3E0 6.79e-45 155 34 4 258 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q5L3R0 1.32e-44 155 36 5 258 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Geobacillus kaustophilus (strain HTA426)
Q8XHV3 1.85e-44 155 36 2 230 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain 13 / Type A)
Q0TMS8 1.85e-44 155 36 2 230 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q97JB8 4.96e-44 154 36 3 245 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q2LY16 9.87e-44 153 37 3 239 3 cbiO Cobalt import ATP-binding protein CbiO Syntrophus aciditrophicus (strain SB)
P40735 1.4e-43 152 35 8 278 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus subtilis (strain 168)
Q67JX4 2.35e-43 152 38 1 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q97EK9 2.68e-43 152 33 4 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8R7Y4 6.18e-43 150 37 3 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q4A5A5 7.91e-43 150 31 6 266 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q2RFS8 2.32e-42 149 36 4 245 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
O59479 2.81e-42 149 35 4 253 3 PH1815 Putative ABC transporter ATP-binding protein PH1815 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q18CJ0 4.81e-42 148 36 4 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridioides difficile (strain 630)
Q67JX3 4.96e-42 149 40 6 244 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8DWR3 5.69e-42 148 35 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 5.69e-42 148 35 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 5.69e-42 148 35 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8DRR9 1.1e-41 147 35 4 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8CRI6 1.32e-41 147 34 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM27 1.32e-41 147 34 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9RKC6 1.45e-41 147 34 3 240 3 SCO3161 Putative ABC transporter ATP-binding protein SCO3161 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q73F67 1.51e-41 147 33 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q7N0N3 1.59e-41 145 38 4 219 3 plu3849 Putative ABC transporter ATP-binding protein plu3849 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8DG84 2.23e-41 147 34 1 229 3 tll2439 Putative ABC transporter ATP-binding protein tll2439 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9HMZ4 5e-41 144 35 2 237 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q81J16 5.48e-41 145 33 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9V2E4 7.45e-41 145 33 4 254 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q6HPN0 8.31e-41 145 33 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 8.31e-41 145 33 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 8.31e-41 145 33 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q8RHL0 8.45e-41 145 32 3 243 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A3DJK3 9.42e-41 145 36 4 250 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q1J982 1.05e-40 145 35 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q9V1Q4 1.06e-40 145 34 4 253 3 PYRAB03730 Putative ABC transporter ATP-binding protein PYRAB03730 Pyrococcus abyssi (strain GE5 / Orsay)
P0C0E9 1.38e-40 144 34 6 273 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 1.38e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 1.38e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 1.38e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 1.38e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 1.38e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 1.38e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 1.38e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q48QM2 1.92e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 1.92e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 1.92e-40 144 34 6 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
Q8PSR0 2.4e-40 150 36 4 244 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 2.6e-34 134 30 6 274 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A0PXX8 2.54e-40 144 33 2 230 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium novyi (strain NT)
Q8XHV2 4.3e-40 143 35 5 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain 13 / Type A)
Q0TMS7 4.3e-40 143 35 5 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q55740 4.49e-40 143 35 3 244 3 sll0385 Putative ABC transporter ATP-binding protein sll0385 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6MSQ2 5.77e-40 144 34 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q63H62 6.99e-40 143 32 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q5L3Q9 7.09e-40 143 40 4 220 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Geobacillus kaustophilus (strain HTA426)
Q38UU0 7.34e-40 143 34 7 286 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8VNL9 9.39e-40 142 34 4 250 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Enterococcus faecium
Q82HA2 1.12e-39 142 34 3 241 3 SAV_3608 Putative ABC transporter ATP-binding protein SAV_3608 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q6F1W4 1.26e-39 143 36 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q8ETV7 2.78e-39 141 34 4 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q890R3 3.62e-39 141 32 3 250 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium tetani (strain Massachusetts / E88)
Q0SQH5 3.65e-39 141 34 5 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium perfringens (strain SM101 / Type A)
Q2SRI2 3.83e-39 141 35 5 233 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8DMX9 4.28e-39 140 33 5 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97N50 4.28e-39 140 33 5 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04HV7 4.28e-39 140 33 5 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q49ZE0 4.61e-39 140 34 4 245 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9HPH7 5.15e-39 139 36 1 206 3 VNG_1631G Putative ABC transporter ATP-binding protein VNG_1631G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q8TQ05 1.96e-38 145 32 2 248 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQ05 1e-32 129 32 6 254 3 MA_1747 Putative ABC transporter ATP-binding protein MA_1747 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A0PXX7 2.13e-38 139 34 3 229 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium novyi (strain NT)
Q97EK8 2.3e-38 139 34 4 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q03I83 2.36e-38 139 37 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M244 2.36e-38 139 37 4 232 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ4 2.36e-38 139 37 4 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus thermophilus (strain CNRZ 1066)
Q8TI16 3.02e-38 138 35 4 243 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q035B2 3.06e-38 139 35 4 245 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8DQY5 3.41e-38 144 35 2 240 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8DQY5 5.84e-27 112 33 8 266 3 spr0430 Putative ABC transporter ATP-binding protein spr0430 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0CZ27 3.5e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 3.5e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
A2RH10 3.73e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J450 3.73e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC9 3.73e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJD0 3.73e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J983 3.73e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMM8 3.73e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B6 3.73e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XI2 3.73e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M1
Q03ZL5 3.75e-38 138 38 2 212 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q48QM3 3.77e-38 138 33 6 263 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A3DJK5 4.39e-38 138 35 4 249 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q9CIS9 4.87e-38 138 34 4 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. lactis (strain IL1403)
Q04EY4 5.15e-38 138 30 5 279 3 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q839D4 6.31e-38 138 33 6 264 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q65P76 6.45e-38 138 35 4 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q0AUL1 6.47e-38 137 34 5 238 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q88XV2 7.71e-38 137 34 4 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A3CRB9 8.05e-38 137 33 8 273 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus sanguinis (strain SK36)
Q8DRS0 1e-37 137 32 4 251 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q74L61 1.54e-37 137 33 2 233 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q03EE4 1.67e-37 137 33 4 242 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q03I82 2.68e-37 136 34 7 272 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q7A470 2.77e-37 135 34 5 255 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain N315)
Q99S47 2.77e-37 135 34 5 255 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5M243 2.92e-37 136 32 6 271 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXJ3 2.92e-37 136 32 6 271 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus thermophilus (strain CNRZ 1066)
Q03PY6 3.04e-37 136 37 5 247 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q5HDY6 3.38e-37 135 34 5 255 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain COL)
Q2FW34 3.38e-37 135 34 5 255 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER7 3.38e-37 135 34 5 255 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain USA300)
Q97SA3 3.45e-37 141 33 2 240 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q97SA3 1.95e-27 114 33 10 262 3 SP_0483 Putative ABC transporter ATP-binding protein SP_0483 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q6GEL3 3.76e-37 135 34 5 255 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MRSA252)
Q38UT9 4.2e-37 135 32 5 262 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8DWR4 4.47e-37 135 33 4 251 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 4.47e-37 135 33 4 251 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 4.47e-37 135 33 4 251 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q8EUF1 4.56e-37 135 31 4 252 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Malacoplasma penetrans (strain HF-2)
Q1WSB9 4.94e-37 135 37 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q50293 5.19e-37 136 30 3 251 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q2YYM4 6.13e-37 135 34 5 255 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q88XV1 7.64e-37 135 37 7 245 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q7NAQ6 9.37e-37 135 32 6 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q74L62 1.12e-36 134 32 4 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q98QH5 1.21e-36 134 33 5 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8NVB5 1.79e-36 134 33 5 253 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MW2)
Q6G799 1.79e-36 134 33 5 253 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus aureus (strain MSSA476)
Q8PY27 3.33e-36 133 34 5 244 3 MM_1037 Putative ABC transporter ATP-binding protein MM_1037 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q5FM62 3.39e-36 133 34 3 226 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q8RD07 4.07e-36 132 33 3 222 3 TTE0246 Putative ABC transporter ATP-binding protein TTE0246 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8XK20 4.28e-36 138 31 2 243 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
Q8XK20 8.81e-24 103 29 6 267 3 CPE1583 Putative ABC transporter ATP-binding protein CPE1583 Clostridium perfringens (strain 13 / Type A)
P70970 4.75e-36 133 34 4 239 3 ecfAB Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus subtilis (strain 168)
Q6XYZ3 5.26e-36 133 32 4 257 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Spiroplasma kunkelii
Q032H4 6.15e-36 132 33 4 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI01 6.15e-36 132 33 4 242 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactococcus lactis subsp. cremoris (strain MG1363)
Q737I0 6.88e-36 138 32 2 253 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q737I0 5.39e-25 107 29 7 263 3 BCE_2668 Putative ABC transporter ATP-binding protein BCE_2668 Bacillus cereus (strain ATCC 10987 / NRS 248)
A2RI02 7.32e-36 132 34 3 240 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q4A8A2 7.49e-36 132 32 4 252 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain 7448)
Q601T5 7.49e-36 132 32 4 252 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain 232)
Q9CIS8 7.56e-36 132 33 3 245 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q8CRI7 7.85e-36 132 31 8 283 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q045Z7 1.05e-35 132 33 2 230 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q5HM28 1.11e-35 132 32 8 274 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P47425 1.12e-35 132 30 2 241 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9KGD6 1.53e-35 132 36 4 234 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9X1Z1 1.54e-35 131 31 5 248 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q890R2 1.75e-35 131 31 4 248 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Clostridium tetani (strain Massachusetts / E88)
A3CRB8 2.22e-35 131 33 4 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus sanguinis (strain SK36)
Q4AA75 2.43e-35 130 32 4 252 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q71WH7 2.75e-35 131 33 7 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serotype 4b (strain F2365)
Q035B3 2.83e-35 131 34 5 254 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q97N51 3.36e-35 130 35 5 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q6F1W5 4.14e-35 133 34 4 242 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q927N8 4.38e-35 130 33 7 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8DMY0 4.43e-35 130 35 5 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV8 4.43e-35 130 35 5 232 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q032H3 5.17e-35 130 33 3 240 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
Q4L885 5.46e-35 130 31 4 251 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Staphylococcus haemolyticus (strain JCSC1435)
Q832R5 5.62e-35 135 32 4 260 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q832R5 1.28e-29 120 32 6 265 3 EF_2153 Putative ABC transporter ATP-binding protein EF_2153 Enterococcus faecalis (strain ATCC 700802 / V583)
Q93D97 6.77e-35 135 32 5 256 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q93D97 3.23e-27 113 31 8 278 3 sdcBA Putative ABC transporter ATP-binding protein SMU_1934c Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
D5AQY6 9.71e-35 129 32 2 243 1 nikO Nickel import ATP-binding protein NikO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8ETV6 1.04e-34 129 32 4 249 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6KHL1 1.33e-34 129 30 4 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q8TYV9 1.55e-34 129 30 4 267 3 MK0182 Putative ABC transporter ATP-binding protein MK0182 Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q890D1 1.62e-34 128 36 1 194 2 larO Nickel import ATP-binding protein LarO Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A0R8K9 2.49e-34 129 32 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
A0ALT7 3.33e-34 128 31 5 257 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8Y454 3.82e-34 128 33 7 265 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q6GDC0 4.38e-34 133 31 3 246 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q6GDC0 2.72e-19 90 29 9 256 3 SAR2766 Putative ABC transporter ATP-binding protein SAR2766 Staphylococcus aureus (strain MRSA252)
Q71WH8 5.5e-34 127 32 6 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serotype 4b (strain F2365)
Q5HCL3 5.96e-34 132 31 3 246 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q5HCL3 1.68e-18 88 29 10 257 3 SACOL2708 Putative ABC transporter ATP-binding protein SACOL2708 Staphylococcus aureus (strain COL)
Q97KZ3 5.99e-34 126 32 1 210 3 CA_C0773 Putative ABC transporter ATP-binding protein CA_C0773 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q4L884 6.23e-34 127 31 6 257 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus haemolyticus (strain JCSC1435)
Q6G4Q8 6.87e-34 125 34 4 210 3 BH02760 Putative ABC transporter ATP-binding protein BH02760 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6HPM9 7.92e-34 127 32 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 7.92e-34 127 32 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
Q8NUH8 8.88e-34 132 31 3 246 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q8NUH8 1.26e-17 85 28 10 257 3 MW2603 Putative ABC transporter ATP-binding protein MW2603 Staphylococcus aureus (strain MW2)
Q6G5Z1 8.88e-34 132 31 3 246 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q6G5Z1 1.26e-17 85 28 10 257 3 SAS2569 Putative ABC transporter ATP-binding protein SAS2569 Staphylococcus aureus (strain MSSA476)
Q99QV7 9.15e-34 132 31 3 246 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q99QV7 1.71e-18 88 29 10 257 3 SAV2684 Putative ABC transporter ATP-binding protein SAV2684 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7A342 9.15e-34 132 31 3 246 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q7A342 1.71e-18 88 29 10 257 3 SA2476 Putative ABC transporter ATP-binding protein SA2476 Staphylococcus aureus (strain N315)
Q8Y455 9.32e-34 127 32 6 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8PUE7 1.44e-33 130 32 3 218 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PUE7 1.04e-23 103 26 3 226 3 MM_2387 Putative ABC transporter ATP-binding protein MM_2387 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q73F66 1.44e-33 127 32 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81PZ8 1.7e-33 131 30 2 253 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q81PZ8 8.64e-28 115 31 6 253 3 BA_2641 Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 Bacillus anthracis
Q927N9 1.91e-33 126 31 6 255 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q6HI76 2.01e-33 131 30 2 253 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HI76 8.15e-28 115 31 6 253 3 BT9727_2424 Putative ABC transporter ATP-binding protein BT9727_2424 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q8ES39 2.29e-33 130 32 1 241 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8ES39 4.56e-30 121 29 8 273 3 OB0804 Putative ABC transporter ATP-binding protein OB0804 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q04BY6 2.33e-33 126 33 3 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBI9 2.33e-33 126 33 3 228 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A0ALT6 2.73e-33 126 31 5 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q6XYZ4 3.16e-33 125 31 4 245 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Spiroplasma kunkelii
Q5FM63 3.6e-33 125 31 7 264 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q03ZL6 3.93e-33 125 31 4 241 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q81J15 5.44e-33 125 32 5 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P47426 6.41e-33 125 30 6 257 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q50294 6.82e-33 124 29 2 250 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q18C09 8.3e-33 125 33 3 227 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q72D73 1.08e-32 124 34 4 218 3 DVU_1056 Putative ABC transporter ATP-binding protein DVU_1056 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q6FAN3 1.33e-32 125 35 4 231 3 metN1 Methionine import ATP-binding protein MetN 1 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q04EY5 1.33e-32 124 29 5 258 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8PY26 2.08e-32 123 34 5 206 3 MM_1038 Putative ABC transporter ATP-binding protein MM_1038 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q045Z8 2.09e-32 123 32 4 246 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q9PPV1 2.39e-32 124 32 4 240 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q04FM1 2.83e-32 123 33 4 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q88ZZ2 4.03e-32 127 33 4 248 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q88ZZ2 6.08e-26 110 32 9 252 3 lp_0149 Putative ABC transporter ATP-binding protein lp_0149 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8TI15 4.05e-32 122 31 6 229 3 MA_4342 Putative ABC transporter ATP-binding protein MA_4342 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q03PY5 4.48e-32 122 33 6 248 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q7NNW9 5.51e-32 121 33 4 241 3 gll0289 Putative ABC transporter ATP-binding protein gll0289 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q58967 1.17e-31 121 32 4 210 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q3A9G5 1.3e-31 122 33 6 261 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q87G35 1.32e-31 126 30 3 250 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87G35 5.93e-25 107 31 7 255 3 VPA1482 Putative ABC transporter ATP-binding protein VPA1482 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6F0V4 1.62e-31 122 33 5 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q73F11 2.06e-31 122 34 4 228 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q9RRL9 2.73e-31 119 35 6 226 3 DR_2469 Putative ABC transporter ATP-binding protein DR_2469 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q49ZD9 3.97e-31 120 29 4 235 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q81IZ6 4.3e-31 121 35 3 218 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A3DDF6 4.54e-31 121 32 4 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q98QH4 5.16e-31 120 30 6 267 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis pulmonis (strain UAB CTIP)
Q8TUR7 5.9e-31 119 34 7 234 3 pstB Phosphate import ATP-binding protein PstB Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q8R9L8 6.1e-31 124 29 2 258 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q8R9L8 1.24e-22 100 28 6 245 3 TTE1589 Putative ABC transporter ATP-binding protein TTE1589 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q81CT8 8.97e-31 124 30 3 250 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81CT8 3.35e-24 105 30 6 253 3 BC_2655 Putative ABC transporter ATP-binding protein BC_2655 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q63H29 9.96e-31 120 34 4 228 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ZK / E33L)
Q7NAQ7 1.13e-30 119 29 2 237 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q03PF2 1.22e-30 120 33 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q5L222 1.25e-30 120 31 3 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q6G1D9 1.59e-30 117 33 4 205 3 BQ02700 Putative ABC transporter ATP-binding protein BQ02700 Bartonella quintana (strain Toulouse)
Q81VM2 1.71e-30 120 34 4 228 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus anthracis
Q38WL5 2.25e-30 119 34 3 210 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q7MFH3 2.56e-30 122 31 3 244 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q7MFH3 1.65e-22 100 29 9 296 3 VVA0347 Putative ABC transporter ATP-binding protein VVA0347 Vibrio vulnificus (strain YJ016)
Q8D3Z9 2.66e-30 122 30 3 244 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q8D3Z9 5.1e-23 101 29 9 296 3 VV2_1533 Putative ABC transporter ATP-binding protein VV2_1533 Vibrio vulnificus (strain CMCP6)
Q6YR39 3.3e-30 117 32 3 245 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Onion yellows phytoplasma (strain OY-M)
Q13LD8 3.92e-30 119 38 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q2YYM5 4.24e-30 117 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q1GBJ0 4.7e-30 117 31 5 249 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q02ME3 5.4e-30 119 35 4 228 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9Z9J3 6.03e-30 117 31 4 247 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6GEL4 6.18e-30 117 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MRSA252)
Q63H61 1.24e-29 116 33 6 254 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ZK / E33L)
Q74I62 1.29e-29 120 30 2 234 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q74I62 1.71e-20 94 28 6 252 3 LJ_1704 Putative ABC transporter ATP-binding protein LJ_1704 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q6LQ00 1.34e-29 120 30 3 255 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q6LQ00 9.25e-21 95 28 7 270 3 PBPRA2240 Putative ABC transporter ATP-binding protein PBPRA2240 Photobacterium profundum (strain SS9)
Q04BY7 1.38e-29 116 30 5 249 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q9PPV2 1.42e-29 119 35 2 181 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q1BR30 1.43e-29 118 38 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia orbicola (strain AU 1054)
A0B344 1.43e-29 118 38 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia cenocepacia (strain HI2424)
Q4A5A4 1.95e-29 116 29 3 248 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasmopsis synoviae (strain 53)
Q2NIT5 2.09e-29 115 31 3 245 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q7CN92 2.53e-29 117 31 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 2.53e-29 117 31 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
Q9WY65 2.59e-29 115 32 4 213 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q39AT4 2.6e-29 117 38 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7AH43 2.77e-29 116 28 4 235 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q8CPN0 2.78e-29 117 32 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q7A088 3e-29 115 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MW2)
Q6G7A0 3e-29 115 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain MSSA476)
Q7A471 3e-29 115 30 6 238 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain N315)
Q99S48 3e-29 115 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDY7 3e-29 115 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain COL)
Q2FW35 3e-29 115 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FER8 3e-29 115 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Staphylococcus aureus (strain USA300)
Q8CQS7 3.08e-29 116 33 4 231 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRU5 3.08e-29 116 33 4 231 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q03AH0 3.45e-29 117 33 5 223 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q8G838 3.47e-29 120 32 2 225 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8G838 5.79e-22 99 31 3 218 3 BL0043 Putative ABC transporter ATP-binding protein BL0043 Bifidobacterium longum (strain NCC 2705)
Q8TQW9 4.1e-29 119 30 3 221 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TQW9 4.29e-26 110 27 4 250 3 MA_1418 Putative ABC transporter ATP-binding protein MA_1418 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q6YRJ4 4.17e-29 119 29 2 246 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q6YRJ4 1.69e-21 97 27 5 262 3 PAM_020 Putative ABC transporter ATP-binding protein PAM_020 Onion yellows phytoplasma (strain OY-M)
Q8TIW9 4.74e-29 114 32 3 214 3 MA_4021 Putative ABC transporter ATP-binding protein MA_4021 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q5HQ70 4.75e-29 116 32 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q73P93 5.07e-29 118 28 4 221 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73P93 6.46e-19 89 28 5 215 3 TDE_0906 Putative ABC transporter ATP-binding protein TDE_0906 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q0BMC9 6.14e-29 115 32 4 230 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 6.14e-29 115 32 4 230 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q1J6Q6 7.73e-29 116 31 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 7.73e-29 116 31 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 7.73e-29 116 31 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 7.73e-29 116 31 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q49WM4 7.93e-29 115 32 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7N8B9 8.58e-29 115 29 4 235 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9I1C8 8.66e-29 115 35 4 228 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8DZJ0 1.05e-28 115 32 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 1.05e-28 115 32 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 1.05e-28 115 32 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5XCA4 1.22e-28 115 30 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ35 1.34e-28 115 30 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 1.34e-28 115 30 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 1.34e-28 115 30 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P37009 1.42e-28 115 29 4 235 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q8TSC8 1.44e-28 117 30 4 255 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8TSC8 2.42e-27 114 31 5 251 3 MA_0870 Putative ABC transporter ATP-binding protein MA_0870 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q0B6I6 1.61e-28 115 38 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8E3S6 1.64e-28 117 28 3 256 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q8E3S6 6.45e-27 112 34 8 246 3 gbs1680 Putative ABC transporter ATP-binding protein gbs1680 Streptococcus agalactiae serotype III (strain NEM316)
Q7VV72 1.92e-28 114 33 4 225 3 metN Methionine import ATP-binding protein MetN Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W4E1 1.92e-28 114 33 4 225 3 metN Methionine import ATP-binding protein MetN Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFU9 1.92e-28 114 33 4 225 3 metN Methionine import ATP-binding protein MetN Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q88ZJ6 2.05e-28 114 31 3 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8DY60 2.5e-28 117 28 3 256 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8DY60 1.12e-26 112 34 8 246 3 SAG1633 Putative ABC transporter ATP-binding protein SAG1633 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q6MSQ1 2.55e-28 115 29 8 261 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q38VW6 3.29e-28 114 32 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q4A8A1 3.68e-28 112 32 3 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain 7448)
Q6KHL2 4.03e-28 112 27 3 243 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q18AM3 4.26e-28 113 33 3 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q14H97 4.96e-28 113 32 4 230 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q4AA74 5.03e-28 112 32 3 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q601T6 5.03e-28 112 32 3 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Mesomycoplasma hyopneumoniae (strain 232)
Q830W6 6.4e-28 113 31 5 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q5ZWE4 6.56e-28 113 31 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A0PY57 6.91e-28 113 33 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q8PVG9 6.94e-28 115 30 5 253 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PVG9 6.16e-27 113 29 4 254 3 MM_1996 Putative ABC transporter ATP-binding protein MM_1996 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q5PCG9 7.16e-28 112 35 5 209 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6NJ07 7.56e-28 112 35 6 212 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
P54537 7.87e-28 110 29 3 226 1 artM Arginine transport ATP-binding protein ArtM Bacillus subtilis (strain 168)
Q9CGD4 9.27e-28 114 32 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. lactis (strain IL1403)
Q03ZQ0 9.57e-28 113 32 4 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q63NI4 1.01e-27 113 37 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain K96243)
Q3JHC9 1.06e-27 113 37 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia pseudomallei (strain 1710b)
Q8H1R4 1.15e-27 110 35 5 207 1 ABCI10 ABC transporter I family member 10 Arabidopsis thaliana
Q62B84 1.2e-27 113 37 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Burkholderia mallei (strain ATCC 23344)
Q9CK97 1.41e-27 112 33 6 254 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q5X627 1.58e-27 112 31 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q5NFU5 1.63e-27 112 31 4 230 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q5WVL8 1.77e-27 112 34 3 214 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Lens)
Q1WVI7 1.79e-27 112 31 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q02Z10 1.91e-27 113 32 5 225 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. cremoris (strain SK11)
Q5WXF0 1.92e-27 112 31 4 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q5ZUG5 2.9e-27 111 33 3 214 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5KVK2 3.13e-27 111 35 3 208 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q0I5E9 3.46e-27 111 33 3 210 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q57S53 3.68e-27 110 34 5 218 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q03JH1 3.95e-27 111 32 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q92EZ6 4.03e-27 110 34 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5LYN4 4.12e-27 111 32 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q8YA75 4.29e-27 110 34 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q5X484 4.5e-27 110 33 3 214 3 metN Methionine import ATP-binding protein MetN Legionella pneumophila (strain Paris)
Q5M397 4.8e-27 111 32 6 235 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q8ZR89 4.8e-27 110 35 5 209 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q724C0 6.4e-27 110 34 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Listeria monocytogenes serotype 4b (strain F2365)
Q8Z8R5 6.74e-27 110 35 6 212 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q8ELA5 7.02e-27 110 33 3 218 3 metN4 Methionine import ATP-binding protein MetN 4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2SSS4 7.78e-27 110 31 5 242 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8FV85 9.26e-27 110 34 6 231 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 9.26e-27 110 34 6 231 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 9.26e-27 110 34 6 231 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 9.26e-27 110 34 6 231 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q6D734 1.06e-26 110 29 4 224 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
O34362 1.12e-26 112 29 3 240 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 5e-25 107 27 6 270 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q6MU19 1.21e-26 109 31 5 242 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
O32169 1.48e-26 109 33 6 232 1 metN Methionine import ATP-binding protein MetN Bacillus subtilis (strain 168)
Q7N8M2 1.51e-26 109 34 3 228 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8XIZ5 1.55e-26 109 33 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 1.55e-26 109 33 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SML1 1.56e-26 109 31 6 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q6LKD4 1.84e-26 109 29 5 223 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q8NY21 1.87e-26 108 32 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MW2)
Q6GC27 1.87e-26 108 32 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MSSA476)
Q4JTG9 2.13e-26 109 32 6 224 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q895C4 2.45e-26 108 30 3 242 3 metN Methionine import ATP-binding protein MetN Clostridium tetani (strain Massachusetts / E88)
Q2SRI1 2.59e-26 109 29 9 262 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8EPK1 2.67e-26 108 33 5 210 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q97KD5 2.7e-26 108 32 5 228 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P44785 3.4e-26 108 33 3 210 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QMH4 3.54e-26 108 33 3 210 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q9X196 3.87e-26 108 32 5 232 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q3KBH4 4.22e-26 108 32 4 234 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain Pf0-1)
Q72GX5 4.25e-26 106 31 5 231 3 pstB Phosphate import ATP-binding protein PstB Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q3Z5F8 4.25e-26 108 35 3 210 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 4.25e-26 108 35 3 210 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 4.25e-26 108 35 3 210 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63356 4.25e-26 108 35 3 210 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
Q325U1 4.71e-26 108 35 3 210 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q0TLD2 4.86e-26 108 35 3 210 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q6GJL2 5.11e-26 107 32 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain MRSA252)
Q5SLN1 5.18e-26 106 31 5 233 3 pstB Phosphate import ATP-binding protein PstB Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q8DUF7 5.25e-26 108 31 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A3CMQ7 5.37e-26 108 30 6 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
Q8RGC8 5.48e-26 108 31 4 217 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P15031 5.58e-26 105 28 6 269 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
Q5HIL5 5.66e-26 107 32 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 5.66e-26 107 32 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 5.66e-26 107 32 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q8DPC2 6.07e-26 108 30 6 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 6.07e-26 108 30 6 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 6.07e-26 108 30 6 237 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P30750 6.67e-26 107 34 3 210 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
Q7A7E3 6.88e-26 107 32 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain N315)
Q99WE1 6.88e-26 107 32 3 217 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q1AS06 6.91e-26 108 33 3 212 3 potA Spermidine/putrescine import ATP-binding protein PotA Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q660M8 7.85e-26 107 30 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q32JQ8 7.93e-26 107 34 3 210 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q897I2 8.9e-26 108 28 3 218 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q897I2 5.36e-16 80 31 1 130 3 CTC_00753 Putative ABC transporter ATP-binding protein CTC_00753 Clostridium tetani (strain Massachusetts / E88)
Q65F80 8.97e-26 107 32 4 231 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q5XDS8 9.06e-26 107 30 5 250 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
O51587 9.15e-26 107 30 5 230 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q65VG9 9.73e-26 107 32 5 240 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q6HG98 1.06e-25 109 33 7 229 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HG98 7.93e-16 80 26 3 225 3 BT9727_3105 Putative ABC transporter ATP-binding protein BT9727_3105 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q39IE7 1.06e-25 107 35 3 212 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8Z990 1.13e-25 107 34 3 210 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhi
Q1LQF6 1.22e-25 107 33 3 214 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q6F9P2 1.24e-25 107 33 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q83MC5 1.27e-25 107 35 3 210 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 1.27e-25 107 35 3 210 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q87AL9 1.32e-25 106 34 3 214 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8RHK9 1.49e-25 105 30 6 249 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P39456 1.51e-25 104 29 4 231 1 tcyC L-cystine import ATP-binding protein TcyC Bacillus subtilis (strain 168)
Q13W55 1.52e-25 105 31 7 238 3 pstB Phosphate import ATP-binding protein PstB Paraburkholderia xenovorans (strain LB400)
Q92LX3 1.63e-25 106 34 3 210 3 metN Methionine import ATP-binding protein MetN Rhizobium meliloti (strain 1021)
Q2YQP3 1.7e-25 104 30 4 217 3 BAB1_1388 Putative ABC transporter ATP-binding protein BAB1_1388 Brucella abortus (strain 2308)
Q57CD8 1.7e-25 104 30 4 217 3 BruAb1_1365 Putative ABC transporter ATP-binding protein BruAb1_1365 Brucella abortus biovar 1 (strain 9-941)
Q5PID0 1.72e-25 106 34 3 210 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q63E84 1.86e-25 106 32 3 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 1.86e-25 106 32 3 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 1.86e-25 106 32 3 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q0SRL2 1.9e-25 106 32 3 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
Q221H2 2.03e-25 104 30 7 240 3 pstB Phosphate import ATP-binding protein PstB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q1WVG9 2.04e-25 106 32 7 234 3 metN Methionine import ATP-binding protein MetN Ligilactobacillus salivarius (strain UCC118)
Q6HLQ9 2.09e-25 105 32 3 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q8P2K6 2.15e-25 106 30 5 250 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q043Y8 2.22e-25 106 30 7 242 3 metN Methionine import ATP-binding protein MetN Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8XXY9 2.45e-25 105 27 6 283 3 nodI Nod factor export ATP-binding protein I Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q032A0 2.48e-25 106 29 8 284 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain SK11)
P0CZ31 2.81e-25 106 30 6 251 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ30 2.81e-25 106 30 6 251 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
D8KFN1 2.83e-25 106 29 8 284 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain NZ9000)
P0CI33 2.83e-25 106 29 8 284 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain MG1363)
Q56953 2.92e-25 105 29 4 237 3 yfeB Chelated iron transport system membrane protein YfeB Yersinia pestis
Q81TH8 3.27e-25 105 32 3 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
P48334 3.33e-25 103 32 3 199 3 None Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region Cyanophora paradoxa
Q7MN25 3.54e-25 105 32 3 210 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain YJ016)
Q8DFC3 3.65e-25 105 32 3 210 3 metN Methionine import ATP-binding protein MetN Vibrio vulnificus (strain CMCP6)
Q8ELR4 3.67e-25 105 26 7 267 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q1JII9 3.81e-25 105 29 5 250 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1BY14 4.25e-25 105 34 3 212 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 4.25e-25 105 34 3 212 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q1JNE0 4.26e-25 105 29 5 250 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JDG6 4.26e-25 105 29 5 250 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q1LKJ2 4.27e-25 104 29 3 212 3 nodI Nod factor export ATP-binding protein I Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q81GC1 4.5e-25 105 32 3 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6D3Q6 5.06e-25 105 33 5 232 3 metN2 Methionine import ATP-binding protein MetN 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q48V78 5.27e-25 105 29 5 250 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q9A1E3 5.27e-25 105 29 5 250 3 metN Methionine import ATP-binding protein MetN Streptococcus pyogenes serotype M1
Q13VD7 5.54e-25 105 34 3 212 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q2NRN5 6.23e-25 105 33 3 220 3 metN Methionine import ATP-binding protein MetN Sodalis glossinidius (strain morsitans)
Q8RFN2 6.31e-25 104 32 7 225 3 metN Methionine import ATP-binding protein MetN Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q73R11 6.67e-25 106 27 3 219 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q73R11 2.27e-23 102 28 4 224 3 TDE_0282 Putative ABC transporter ATP-binding protein TDE_0282 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8FZV2 7.18e-25 102 29 4 217 3 BR1368 Putative ABC transporter ATP-binding protein BR1368/BS1330_I1363 Brucella suis biovar 1 (strain 1330)
Q57T09 7.18e-25 104 34 3 210 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella choleraesuis (strain SC-B67)
Q1CR30 7.34e-25 104 34 5 213 3 metN Methionine import ATP-binding protein MetN Helicobacter pylori (strain HPAG1)
Q9PF03 7.39e-25 104 33 3 214 3 metN Methionine import ATP-binding protein MetN Xylella fastidiosa (strain 9a5c)
Q97KS6 7.46e-25 105 29 3 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8ZRM9 7.71e-25 104 34 3 210 3 metN1 Methionine import ATP-binding protein MetN 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P45092 7.74e-25 102 30 1 223 3 artP Arginine transport ATP-binding protein ArtP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q667L9 8.54e-25 104 34 3 210 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q4ZRT7 8.69e-25 102 30 8 242 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas syringae pv. syringae (strain B728a)
Q880A6 8.69e-25 102 30 8 242 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9S4Z0 8.93e-25 103 32 7 238 3 metN Methionine import ATP-binding protein MetN Salmonella enteritidis
Q9A502 9.35e-25 104 35 3 199 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2YVT7 9.37e-25 104 32 3 210 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q81N53 9.41e-25 106 32 7 229 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
Q81N53 1.54e-16 82 26 3 225 3 BA_3364 Putative ABC transporter ATP-binding protein BA_3364/GBAA_3364/BAS3118 Bacillus anthracis
Q48HD9 9.84e-25 102 30 8 242 3 pstB1 Phosphate import ATP-binding protein PstB 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8Y651 1.17e-24 102 31 4 238 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q2KVK2 1.23e-24 104 31 4 225 3 metN Methionine import ATP-binding protein MetN Bordetella avium (strain 197N)
Q04G50 1.28e-24 104 29 4 231 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q92AF9 1.31e-24 102 31 4 238 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8Y8T6 1.42e-24 104 30 5 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9KLQ5 1.44e-24 103 26 5 237 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O85818 1.49e-24 104 30 6 236 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
A0AGP9 1.57e-24 104 30 5 220 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13755
Feature type CDS
Gene -
Product ATP-binding cassette domain-containing protein
Location 384423 - 385271 (strand: 1)
Length 849 (nucleotides) / 282 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_378
Orthogroup size 8
N. genomes 6

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1122 Inorganic ion transport and metabolism (P)
General function prediction only (R)
PR Energy-coupling factor transporter ATP-binding protein EcfA2

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02006 cobalt/nickel transport system ATP-binding protein ABC transporters -

Protein Sequence

MNQRPQLAVNDLTFRYQDDNILKNLTMDFSEHQVTGIIGANGCGKSTLFMNLSGILKPQHGQVLWQGKPLNYNKKALLDLRSHVVTVFQDPDLQIFYTDVDSDIAFALRNLGMDEAEIKHRTDEALRLVDALSFRDKPIQHLSFGQKKRVAIAGALVMESDYLLLDEPTAGLDPAGRQHMIALLARIAAAGKHIVISSHDIDLIYQVCDGIYVMSHGEVCGHGTPEAVFLQKEMITAAGLEQPWLVKLHCETGLPLCKTEQALFAQLQQQTTPAAGTREVMA

Flanking regions ( +/- flanking 50bp)

CAAATGTCAGTTGCACTCGATGTGAAGTTATATCAGGGGAATTTTCATATATGAACCAGCGCCCTCAATTAGCCGTTAATGACCTTACTTTTCGCTATCAGGATGATAATATTCTGAAAAACCTGACTATGGATTTCAGTGAACATCAGGTAACGGGAATTATCGGCGCAAACGGCTGCGGAAAATCTACCCTGTTTATGAATTTATCCGGTATTCTCAAACCGCAGCACGGACAGGTTCTCTGGCAGGGCAAACCGCTGAATTACAACAAAAAAGCCCTTCTTGATCTGCGTTCGCACGTTGTGACGGTCTTTCAGGATCCGGATTTACAGATCTTTTATACTGATGTGGACAGCGATATCGCCTTTGCCCTGCGCAACCTAGGGATGGATGAAGCAGAGATAAAACACCGGACAGATGAAGCGCTGCGTCTGGTTGATGCCCTCTCTTTCCGCGATAAGCCGATTCAGCACCTGAGTTTCGGGCAGAAAAAACGGGTCGCGATCGCCGGTGCGCTGGTGATGGAATCAGACTATCTGCTGCTCGATGAACCCACTGCCGGACTTGATCCCGCCGGACGGCAGCATATGATCGCCCTGCTCGCCCGCATTGCCGCCGCAGGCAAACACATTGTTATTTCCAGCCATGACATTGACCTTATCTATCAGGTTTGTGATGGTATTTACGTGATGTCGCACGGCGAAGTGTGCGGTCACGGCACACCGGAAGCGGTTTTCCTGCAAAAAGAGATGATAACCGCCGCCGGTCTGGAACAGCCCTGGCTGGTCAAACTTCACTGTGAAACCGGTCTGCCGCTGTGTAAAACTGAACAGGCGCTGTTTGCACAACTGCAACAGCAGACAACTCCCGCCGCCGGGACACGAGAGGTAATGGCATGACAGTTTCACTGATGATCCAGGGCACCGCTTCCGATGTCGGAAAAAGTGTA