Homologs in group_374

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14075 FBDBKF_14075 100.0 Morganella morganii S1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
EHELCC_08205 EHELCC_08205 100.0 Morganella morganii S2 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
NLDBIP_08530 NLDBIP_08530 100.0 Morganella morganii S4 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
HKOGLL_05180 HKOGLL_05180 100.0 Morganella morganii S5 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
F4V73_RS02860 F4V73_RS02860 95.1 Morganella psychrotolerans menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
PMI_RS08555 PMI_RS08555 90.5 Proteus mirabilis HI4320 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
PMI_RS13095 PMI_RS13095 31.0 Proteus mirabilis HI4320 caiD crotonobetainyl-CoA hydratase

Distribution of the homologs in the orthogroup group_374

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_374

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CQ56 0.0 531 86 0 285 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0ABU0 0.0 528 86 0 285 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Escherichia coli (strain K12)
P0ABU1 0.0 528 86 0 285 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P44960 0.0 523 83 0 285 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CLV5 0.0 523 85 0 285 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Pasteurella multocida (strain Pm70)
P23966 2.3e-134 384 68 2 264 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Bacillus subtilis (strain 168)
Q49WG8 4.42e-130 373 67 2 265 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L549 3.8e-128 368 66 1 262 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus haemolyticus (strain JCSC1435)
Q5HQC3 1.27e-127 367 66 1 254 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CPQ4 1.59e-127 366 66 1 254 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8NXA0 1.01e-126 364 64 1 262 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain MW2)
Q6GAG7 1.01e-126 364 64 1 262 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain MSSA476)
Q6GI37 1.83e-126 363 64 1 262 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain MRSA252)
Q5HH38 1.83e-126 363 64 1 262 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain COL)
Q7A6A9 2.81e-126 363 64 1 262 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain N315)
Q99V48 2.81e-126 363 64 1 262 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8GYN9 3.46e-125 363 65 2 266 1 MENB 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal Arabidopsis thaliana
Q9TM10 2.68e-116 338 61 2 261 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Cyanidium caldarium
A0QRD3 6.39e-78 241 46 6 296 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WNP5 1.06e-77 241 47 5 286 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNP4 1.06e-77 241 47 5 286 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WNN9 2.94e-35 130 37 6 261 1 echA8 Probable enoyl-CoA hydratase EchA8 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN8 2.94e-35 130 37 6 261 3 echA8 Probable enoyl-CoA hydratase echA8 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64017 2.94e-35 130 37 6 261 3 echA8 Probable enoyl-CoA hydratase echA8 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A4YI89 4.83e-35 130 34 4 244 1 Msed_2001 3-hydroxypropionyl-coenzyme A dehydratase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
P52046 1.1e-33 126 32 5 263 1 crt Short-chain-enoyl-CoA hydratase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q1ZXF1 1.43e-33 126 35 5 248 3 echs1 Probable enoyl-CoA hydratase, mitochondrial Dictyostelium discoideum
Q0AVM1 3.04e-33 125 33 5 262 1 Swol_1936 Crotonyl-CoA hydratase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
O34893 3.17e-33 125 32 5 256 3 yngF Putative enoyl-CoA hydratase/isomerase YngF Bacillus subtilis (strain 168)
Q3TLP5 3.67e-31 120 31 5 269 1 Echdc2 Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Mus musculus
O07137 1.2e-30 118 35 5 246 3 echA8 Probable enoyl-CoA hydratase echA8 Mycobacterium leprae (strain TN)
Q86YB7 5.51e-30 117 32 5 253 1 ECHDC2 Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Homo sapiens
Q8BH95 8.29e-30 117 32 6 264 1 Echs1 Enoyl-CoA hydratase, mitochondrial Mus musculus
G4V4T7 8.79e-30 116 32 5 265 1 dpgD Enoyl-CoA-hydratase Amycolatopsis orientalis
Q5SKU3 1.05e-29 115 32 7 262 1 TTHA0550 Putative enoyl-CoA hydratase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P14604 1.69e-29 116 32 6 264 1 Echs1 Enoyl-CoA hydratase, mitochondrial Rattus norvegicus
P34559 1.99e-29 115 32 5 251 3 ech-6 Probable enoyl-CoA hydratase, mitochondrial Caenorhabditis elegans
Q2TBT3 3.17e-29 115 30 5 280 2 ECHDC2 Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Bos taurus
Q9KJE7 3.77e-29 114 30 5 255 1 bbsH (E)-benzylidenesuccinyl-CoA hydratase Thauera aromatica
O69762 5.1e-29 114 35 6 212 1 None Hydroxycinnamoyl-CoA hydratase-lyase Pseudomonas fluorescens
P30084 9.32e-29 114 32 5 245 1 ECHS1 Enoyl-CoA hydratase, mitochondrial Homo sapiens
Q5R646 8.92e-28 111 33 5 245 2 ECHS1 Enoyl-CoA hydratase, mitochondrial Pongo abelii
P76082 1.7e-27 110 32 6 245 1 paaF 2,3-dehydroadipyl-CoA hydratase Escherichia coli (strain K12)
Q58DM8 3.66e-27 110 30 7 285 2 ECHS1 Enoyl-CoA hydratase, mitochondrial Bos taurus
Q52995 1.17e-26 107 33 8 263 3 fadB1 Probable enoyl-CoA hydratase Rhizobium meliloti (strain 1021)
F4JML5 4.79e-25 104 28 5 254 2 At4g16800 Probable enoyl-CoA hydratase 2, mitochondrial Arabidopsis thaliana
Q96DC8 7.11e-25 104 32 4 249 1 ECHDC3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Homo sapiens
Q39TV7 1.34e-24 104 34 1 173 1 bamA 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9D7J9 9.43e-24 101 32 5 253 1 Echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Mus musculus
Q3MIE0 2.44e-23 100 31 7 257 2 Echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Rattus norvegicus
Q4PEN0 2.72e-23 99 26 6 264 1 fer4 Enoyl-CoA isomerase/hydratase fer4 Ustilago maydis (strain 521 / FGSC 9021)
Q8Z9L5 2.78e-23 99 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella typhi
A8ALR7 2.99e-23 99 30 5 256 3 caiD Carnitinyl-CoA dehydratase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P59395 3.21e-23 99 31 6 260 3 caiD Carnitinyl-CoA dehydratase Shigella flexneri
B4T6J5 3.38e-23 98 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella newport (strain SL254)
B1LFW9 3.56e-23 98 31 6 260 3 caiD Carnitinyl-CoA dehydratase Escherichia coli (strain SMS-3-5 / SECEC)
P31551 4.07e-23 98 31 6 260 1 caiD Carnitinyl-CoA dehydratase Escherichia coli (strain K12)
B1IRE0 4.07e-23 98 31 6 260 3 caiD Carnitinyl-CoA dehydratase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8XA35 4.66e-23 98 31 6 260 3 caiD Carnitinyl-CoA dehydratase Escherichia coli O157:H7
Q8FLA6 5.43e-23 98 31 6 260 3 caiD Carnitinyl-CoA dehydratase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLV3 5.43e-23 98 31 6 260 3 caiD Carnitinyl-CoA dehydratase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B5RGA4 5.61e-23 98 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1Q9 5.61e-23 98 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella enteritidis PT4 (strain P125109)
Q8ZRX5 5.96e-23 98 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TWR3 5.96e-23 98 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella schwarzengrund (strain CVM19633)
B4TIG9 5.96e-23 98 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella heidelberg (strain SL476)
Q73VC7 6.38e-23 97 31 5 211 3 echA17 Probable enoyl-CoA hydratase echA17 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QJH8 7.76e-23 97 30 5 216 3 echA17 Probable enoyl-CoA hydratase echA17 Mycobacterium avium (strain 104)
A5JTM5 8.69e-23 97 34 4 208 1 None 4-chlorobenzoyl coenzyme A dehalogenase Pseudomonas sp. (strain CBS-3)
B5BL54 9.38e-23 97 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi A (strain AKU_12601)
C0Q4L2 9.38e-23 97 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi C (strain RKS4594)
Q5PIL1 9.38e-23 97 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57TJ1 9.38e-23 97 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella choleraesuis (strain SC-B67)
B5F749 9.38e-23 97 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella agona (strain SL483)
A9MYJ5 1.25e-22 97 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5FHG4 1.25e-22 97 30 5 256 3 caiD Carnitinyl-CoA dehydratase Salmonella dublin (strain CT_02021853)
P9WNP1 1.6e-22 96 29 6 250 1 echA6 Probable enoyl-CoA hydratase EchA6 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNP0 1.6e-22 96 29 6 250 3 echA6 Probable enoyl-CoA hydratase echA6 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64015 1.6e-22 96 29 6 250 3 echA6 Probable enoyl-CoA hydratase echA6 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8GB17 1.7e-22 97 29 5 260 1 caiD Carnitinyl-CoA dehydratase Proteus sp. (strain LE138)
B4EY26 1.7e-22 97 29 5 260 3 caiD Carnitinyl-CoA dehydratase Proteus mirabilis (strain HI4320)
P52045 4.43e-22 95 29 4 251 1 scpB Methylmalonyl-CoA decarboxylase Escherichia coli (strain K12)
O87872 1.05e-21 96 32 1 171 1 oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Thauera aromatica
A9MR28 1.4e-21 94 30 4 250 3 caiD Carnitinyl-CoA dehydratase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P9WNN3 2.19e-21 94 29 4 206 1 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN2 2.19e-21 94 29 4 206 3 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U753 2.19e-21 94 29 4 206 3 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KN36 2.19e-21 94 29 4 206 3 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7TXE1 2.19e-21 94 29 4 206 1 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O53561 2.33e-21 94 28 5 248 1 echA19 Enoyl-CoA hydratase EchA19 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A9JS71 1.01e-20 92 29 9 264 2 echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Xenopus laevis
Q6NL24 1.45e-20 91 30 8 229 1 ECHIA Probable enoyl-CoA hydratase 1, peroxisomal Arabidopsis thaliana
Q9WUR2 3.4e-20 92 30 4 214 1 Eci2 Enoyl-CoA delta isomerase 2 Mus musculus
P94549 3.56e-20 90 31 5 247 2 fadB Probable enoyl-CoA hydratase Bacillus subtilis (strain 168)
A0PJR5 3.92e-20 90 28 5 263 2 echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Danio rerio
Q7U004 5.41e-20 90 28 5 264 3 echA12 Probable enoyl-CoA hydratase echA12 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WNN7 8.88e-20 90 28 5 264 1 echA12 Probable enoyl-CoA hydratase EchA12 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN6 8.88e-20 90 28 5 264 3 echA12 Probable enoyl-CoA hydratase echA12 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q54HG7 1.4e-19 89 25 4 249 3 auh Methylglutaconyl-CoA hydratase, mitochondrial Dictyostelium discoideum
Q78JN3 1.72e-19 89 30 6 218 1 Eci3 Enoyl-CoA delta isomerase 3, peroxisomal Mus musculus
Q9JLZ3 1.74e-19 89 30 5 259 1 Auh Methylglutaconyl-CoA hydratase, mitochondrial Mus musculus
Q4WF54 6.62e-19 87 28 4 253 1 sidH Mevalonyl-coenzyme A hydratase sidH Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q2LXU2 8.17e-19 88 27 2 186 1 bamA 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Syntrophus aciditrophicus (strain SB)
F1LU71 1.22e-18 87 29 5 259 1 Auh Methylglutaconyl-CoA hydratase, mitochondrial Rattus norvegicus
A0R4Q3 1.95e-18 85 27 6 249 3 echA19 Enoyl-CoA hydratase EchA19 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9LCU3 2.46e-18 85 30 5 210 1 fcbB2 4-chlorobenzoyl coenzyme A dehalogenase-2 Arthrobacter sp.
Q50130 4.28e-18 84 27 6 253 3 echA6 Probable enoyl-CoA hydratase echA6 Mycobacterium leprae (strain TN)
O85078 4.59e-18 85 30 5 210 1 fcbB1 4-chlorobenzoyl coenzyme A dehalogenase-1 Arthrobacter sp.
Q589W8 4.97e-18 85 28 5 250 3 ACTT3 Enoyl-CoA hydratase ACTT3 Alternaria alternata
A0A481WNM8 6.6e-18 87 28 6 259 3 claC Enoyl-CoA isomerase/hydratase claC Penicillium crustosum
Q13825 7.2e-18 85 29 5 259 1 AUH Methylglutaconyl-CoA hydratase, mitochondrial Homo sapiens
F9XMX6 7.4e-18 85 24 5 260 3 MYCGRDRAFT_76805 Enoyl-CoA isomerase/hydratase MYCGRDRAFT_76805 Zymoseptoria tritici (strain CBS 115943 / IPO323)
Q9P4U9 1.47e-17 84 29 6 257 3 AKT3-1 Enoyl-CoA hydratase AKT3-1 Alternaria alternata
Q9P4U7 3.61e-17 82 28 6 256 3 AKT3-2 Enoyl-CoA hydratase AKT3-2 Alternaria alternata
O75521 3.76e-17 84 30 5 219 1 ECI2 Enoyl-CoA delta isomerase 2 Homo sapiens
Q8DSN0 4.24e-17 82 26 5 264 3 fabM Trans-2-decenoyl-[acyl-carrier-protein] isomerase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5XIC0 8.79e-17 82 30 4 191 1 Eci2 Enoyl-CoA delta isomerase 2 Rattus norvegicus
P77467 9.8e-17 81 29 6 265 1 paaG 1,2-epoxyphenylacetyl-CoA isomerase Escherichia coli (strain K12)
P41942 1.98e-16 80 25 2 209 3 B0272.4 Uncharacterized protein B0272.4 Caenorhabditis elegans
Q96VB3 4.51e-16 79 28 6 257 3 AFT3-1 Enoyl-CoA hydratase AFT3-1 Alternaria alternata
P53526 1.31e-15 78 31 4 175 3 echA12 Probable enoyl-CoA hydratase echA12 Mycobacterium leprae (strain TN)
Q54SS0 1.55e-15 78 27 9 285 3 ech1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Dictyostelium discoideum
P45361 1.87e-15 75 35 3 153 3 crt Short-chain-enoyl-CoA hydratase (Fragment) Clostridioides difficile
Q9Y6F8 2.56e-15 79 26 7 240 1 CDY1 Testis-specific chromodomain protein Y 1 Homo sapiens
Q9Y6F7 7.71e-15 77 27 7 240 1 CDY2A Testis-specific chromodomain protein Y 2 Homo sapiens
Q39659 1.03e-14 77 30 3 193 1 None Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a Cucumis sativus
Q5ZJ60 1.6e-14 76 31 2 160 2 HIBCH 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Gallus gallus
P24162 1.68e-14 74 29 8 272 3 fadB1 Probable enoyl-CoA hydratase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q9XB60 2.93e-14 73 27 3 218 1 carB Carboxymethylproline synthase Pectobacterium carotovorum subsp. carotovorum
Q9FHR8 6.62e-14 73 25 6 272 1 DCI1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal Arabidopsis thaliana
Q55GS6 7.68e-14 74 31 3 161 3 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Dictyostelium discoideum
Q5RFG0 1.46e-13 73 27 8 234 2 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Pongo abelii
Q13011 2.43e-13 72 27 8 234 1 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Homo sapiens
Q2HJD5 3.34e-13 72 24 5 220 2 ECHDC1 Ethylmalonyl-CoA decarboxylase Bos taurus
Q5LLW6 5.58e-13 70 23 4 235 1 dmdD Methylthioacryloyl-CoA hydratase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9D9V3 9.86e-13 70 25 6 222 1 Echdc1 Ethylmalonyl-CoA decarboxylase Mus musculus
Q5R4W0 1.28e-12 70 24 6 225 2 ECHDC1 Ethylmalonyl-CoA decarboxylase Pongo abelii
Q9NTX5 1.52e-12 70 24 6 225 1 ECHDC1 Ethylmalonyl-CoA decarboxylase Homo sapiens
B1IXA5 1.59e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8DR19 1.63e-12 69 26 6 259 1 fabM Trans-2-decenoyl-[acyl-carrier-protein] isomerase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q3YZM2 2e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Shigella sonnei (strain Ss046)
Q83QQ0 2e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Shigella flexneri
P95279 2.14e-12 69 26 6 244 2 echA13 Putative enoyl-CoA hydratase EchA13 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q0T2E6 2.15e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Shigella flexneri serotype 5b (strain 8401)
B5YXY4 2.47e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7 (strain EC4115 / EHEC)
B1LME7 2.69e-12 70 26 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain SMS-3-5 / SECEC)
Q8XCP2 2.76e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7
A8A2L0 2.92e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O9:H4 (strain HS)
B7LBJ5 3.12e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain 55989 / EAEC)
B2TWV4 3.2e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7M6M2 3.2e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O8 (strain IAI1)
B7NP24 3.39e-12 70 26 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q6NYL3 3.46e-12 70 31 5 174 2 ehhadh Peroxisomal bifunctional enzyme Danio rerio
B6I6Q4 3.52e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain SE11)
Q6AYK9 3.63e-12 69 26 9 275 1 Cdyl Chromodomain Y-like protein Rattus norvegicus
A7ZPF8 3.65e-12 70 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0S7P8 4.33e-12 68 28 7 214 1 echA20 (7aS)-7a-methyl-1,5-dioxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA hydrolase Rhodococcus jostii (strain RHA1)
Q9WTK2 4.59e-12 69 27 7 238 1 Cdyl Chromodomain Y-like protein Mus musculus
Q5HZQ8 4.59e-12 68 27 6 248 2 echdc1 Ethylmalonyl-CoA decarboxylase Xenopus laevis
Q32DJ4 5.73e-12 69 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Shigella dysenteriae serotype 1 (strain Sd197)
B7N5V2 5.95e-12 69 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FFG4 6.23e-12 69 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q31YB7 8.53e-12 68 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Shigella boydii serotype 4 (strain Sb227)
B7MGV7 9.01e-12 68 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFZ8 9.01e-12 68 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1R972 9.35e-12 68 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain UTI89 / UPEC)
A1ADI8 9.35e-12 68 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O1:K1 / APEC
Q62651 9.51e-12 67 26 7 210 1 Ech1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Rattus norvegicus
Q0TFA6 9.53e-12 68 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MY16 1.01e-11 68 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O81 (strain ED1a)
P77399 2.53e-11 67 25 4 203 1 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12)
B1X9L4 2.53e-11 67 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / DH10B)
C4ZVN2 2.53e-11 67 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / MC4100 / BW2952)
A8ADP2 2.7e-11 67 25 4 211 3 fadJ Fatty acid oxidation complex subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q1Q8J9 3.41e-11 67 27 5 199 3 fadB Fatty acid oxidation complex subunit alpha Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7MZ92 3.48e-11 67 25 3 196 3 fadB Fatty acid oxidation complex subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B5BBA1 3.59e-11 67 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain AKU_12601)
Q5PCX6 3.59e-11 67 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q4FQC6 3.63e-11 67 27 5 195 3 fadB Fatty acid oxidation complex subunit alpha Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q9Y232 3.71e-11 66 26 5 234 1 CDYL Chromodomain Y-like protein Homo sapiens
O35459 3.78e-11 66 26 13 296 1 Ech1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Mus musculus
Q869N6 3.81e-11 65 26 10 256 3 DDB_G0271866 3-hydroxybutyryl-CoA dehydratase-like protein, mitochondrial Dictyostelium discoideum
A2VDC2 4.29e-11 66 30 1 142 2 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Xenopus laevis
Q9D5D8 5.53e-11 66 25 5 235 1 Cdyl2 Chromodomain Y-like protein 2 Mus musculus
Q8N8U2 5.98e-11 66 25 5 235 1 CDYL2 Chromodomain Y-like protein 2 Homo sapiens
P40802 8.42e-11 64 26 6 218 1 pksI Putative polyketide biosynthesis enoyl-CoA isomerase PksI Bacillus subtilis (strain 168)
Q8QZS1 8.46e-11 65 30 2 143 1 Hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Mus musculus
Q6AYG5 9.4e-11 64 25 7 227 1 Echdc1 Ethylmalonyl-CoA decarboxylase Rattus norvegicus
Q08426 1.04e-10 65 29 7 206 1 EHHADH Peroxisomal bifunctional enzyme Homo sapiens
V5XZU2 1.08e-10 64 26 6 207 3 AKT6-1 Enoyl-CoA hydratase AKT6-1 Alternaria alternata
Q1K7A4 1.1e-10 65 30 4 163 1 ehd3 Small ribosomal subunit protein mS47 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q58EB4 1.67e-10 64 30 3 156 2 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Danio rerio
Q5R5M8 1.69e-10 65 29 7 206 2 EHHADH Peroxisomal bifunctional enzyme Pongo abelii
V5XZU7 1.81e-10 63 26 5 190 3 AFT6-1 Enoyl-CoA hydratase AFT6-1 Alternaria alternata
O07533 2.22e-10 63 26 7 249 3 yhaR Putative enoyl-CoA hydratase/isomerase YhaR Bacillus subtilis (strain 168)
Q8ZNA7 2.26e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5RCL3 2.3e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q8Z4Z0 2.34e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella typhi
Q57LW6 2.34e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella choleraesuis (strain SC-B67)
B4TCA8 2.36e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella heidelberg (strain SL476)
B5R3R9 2.36e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella enteritidis PT4 (strain P125109)
B5EZR9 2.36e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella agona (strain SL483)
A9N453 2.39e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SZR0 2.45e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella newport (strain SL254)
B5FPN1 2.54e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella dublin (strain CT_02021853)
A4WCW6 2.89e-10 64 26 5 213 3 fadJ Fatty acid oxidation complex subunit alpha Enterobacter sp. (strain 638)
B4TQC2 3.08e-10 64 25 4 203 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella schwarzengrund (strain CVM19633)
Q5QXM1 4.32e-10 63 27 3 182 3 fadJ Fatty acid oxidation complex subunit alpha Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q6NVY1 4.33e-10 63 26 2 156 1 HIBCH 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Homo sapiens
A5WH99 4.54e-10 63 28 6 196 3 fadB Fatty acid oxidation complex subunit alpha Psychrobacter sp. (strain PRwf-1)
P9WNN5 5.1e-10 62 31 3 183 1 echA14 Probable enoyl-CoA hydratase EchA14 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN4 5.1e-10 62 31 3 183 3 echA14 Probable enoyl-CoA hydratase echA14 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64019 5.1e-10 62 31 3 183 1 echA14 Probable enoyl-CoA hydratase echA14 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
C5NN19 5.21e-10 62 26 4 172 3 ACTT6 Enoyl-CoA hydratase ACTT6 Alternaria alternata
Q5XIE6 6.61e-10 62 28 2 145 1 Hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Rattus norvegicus
Q9ZPI6 9.29e-10 62 30 6 206 1 AIM1 Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 Arabidopsis thaliana
P55100 9.57e-10 62 28 7 231 2 EHHADH Peroxisomal bifunctional enzyme Cavia porcellus
B7LLD0 1.06e-09 62 25 4 211 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
I6Y3U6 1.09e-09 60 24 5 242 1 echA20 (7aS)-7a-methyl-1,5-dioxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA hydrolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7N288 1.31e-09 62 26 3 183 3 fadJ Fatty acid oxidation complex subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2HJ73 1.55e-09 61 29 3 148 2 HIBCH 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Bos taurus
F1NB38 1.57e-09 61 25 6 221 3 ECHDC1 Ethylmalonyl-CoA decarboxylase Gallus gallus
Q28C91 1.76e-09 60 26 4 182 2 echdc1 Ethylmalonyl-CoA decarboxylase Xenopus tropicalis
Q28FR6 1.84e-09 61 30 1 142 2 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Xenopus tropicalis
Q6LW06 2.23e-09 61 25 2 192 3 fadB Fatty acid oxidation complex subunit alpha Photobacterium profundum (strain SS9)
Q9DBM2 3.07e-09 61 29 5 189 1 Ehhadh Peroxisomal bifunctional enzyme Mus musculus
A8G8D1 3.29e-09 60 24 2 202 3 fadB Fatty acid oxidation complex subunit alpha Serratia proteamaculans (strain 568)
A6WHA0 3.96e-09 60 26 4 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS185)
Q8W1L6 4.4e-09 60 30 2 190 1 MFP Peroxisomal fatty acid beta-oxidation multifunctional protein Oryza sativa subsp. japonica
B8E3R3 5.21e-09 60 26 4 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS223)
Q6D2L7 5.25e-09 60 25 4 181 3 fadJ Fatty acid oxidation complex subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JK30 5.33e-09 60 38 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A3CYJ4 6.03e-09 60 26 4 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS155 / ATCC BAA-1091)
O49809 7.4e-09 60 29 3 193 2 None Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a Brassica napus
Q8EKR9 8.69e-09 59 26 6 224 3 fadB Fatty acid oxidation complex subunit alpha Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
G4V4T6 1.07e-08 59 27 10 287 1 dpgC (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase Amycolatopsis orientalis
A9KU91 1.11e-08 59 25 4 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS195)
O74802 1.27e-08 58 26 3 160 1 snr1 Small ribosomal subunit protein mS47 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B1KCZ3 1.42e-08 58 25 4 197 3 fadB Fatty acid oxidation complex subunit alpha Shewanella woodyi (strain ATCC 51908 / MS32)
Q08A39 1.53e-08 58 24 3 198 3 fadB Fatty acid oxidation complex subunit alpha Shewanella frigidimarina (strain NCIMB 400)
A3QFP3 1.7e-08 58 27 5 196 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A7MH81 1.92e-08 58 24 3 182 3 fadJ Fatty acid oxidation complex subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
Q8DDK6 2.05e-08 58 25 4 220 3 fadB Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain CMCP6)
B5XVW2 2.39e-08 58 25 4 211 3 fadJ Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae (strain 342)
Q0I0T3 2.45e-08 58 24 5 224 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-7)
Q0HPB7 2.59e-08 58 25 6 224 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-4)
A0KR50 2.79e-08 58 25 6 224 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain ANA-3)
Q1PEY5 4.07e-08 57 28 3 150 2 At2g30650 Probable 3-hydroxyisobutyryl-CoA hydrolase 2 Arabidopsis thaliana
A4TM82 4.49e-08 57 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis (strain Pestoides F)
Q668V1 4.75e-08 57 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CHK2 4.87e-08 57 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZD45 4.87e-08 57 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis
Q1C660 4.87e-08 57 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Antiqua)
A7FGK1 4.87e-08 57 36 1 94 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A0KEL1 4.89e-08 57 24 3 197 3 fadB Fatty acid oxidation complex subunit alpha Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B6EGU2 5.95e-08 57 22 6 222 3 fadB Fatty acid oxidation complex subunit alpha Aliivibrio salmonicida (strain LFI1238)
C6DAL7 6.12e-08 57 23 3 192 3 fadJ Fatty acid oxidation complex subunit alpha Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1RDW6 6.26e-08 57 25 4 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain W3-18-1)
A4Y1B6 6.26e-08 57 25 4 195 3 fadB Fatty acid oxidation complex subunit alpha Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8KLK7 8.37e-08 56 25 4 264 1 BU52_01220 (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase Streptomyces toyocaensis
A1JIG4 8.57e-08 56 25 3 186 3 fadB Fatty acid oxidation complex subunit alpha Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q07ZP8 9.05e-08 56 27 6 196 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella frigidimarina (strain NCIMB 400)
A4XSM8 1.14e-07 56 24 4 221 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas mendocina (strain ymp)
A3Q8U4 1.54e-07 55 25 5 222 3 fadB Fatty acid oxidation complex subunit alpha Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q32A21 1.57e-07 55 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Shigella dysenteriae serotype 1 (strain Sd197)
A3D684 1.67e-07 55 27 4 193 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS155 / ATCC BAA-1091)
P07896 1.72e-07 55 28 6 191 1 Ehhadh Peroxisomal bifunctional enzyme Rattus norvegicus
B0TL21 1.9e-07 55 27 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella halifaxensis (strain HAW-EB4)
Q9ZPI5 2.45e-07 55 28 3 192 1 MFP2 Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 Arabidopsis thaliana
A8A6V1 3.16e-07 55 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O9:H4 (strain HS)
Q7MQH9 3.18e-07 55 24 4 220 3 fadB Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain YJ016)
Q83PG1 3.37e-07 55 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Shigella flexneri
Q0SZ36 3.37e-07 55 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Shigella flexneri serotype 5b (strain 8401)
B1LM32 3.37e-07 55 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain SMS-3-5 / SECEC)
A1RI92 3.43e-07 54 27 4 193 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain W3-18-1)
B5YY93 3.85e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X8I2 3.85e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7
B7NFE7 3.89e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A4STF2 3.97e-07 54 23 3 207 3 fadB Fatty acid oxidation complex subunit alpha Aeromonas salmonicida (strain A449)
Q8FBI2 4.14e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7NV20 4.14e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q9SHJ8 4.15e-07 54 24 2 188 1 At1g06550 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 Arabidopsis thaliana
Q0TAL0 4.34e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q5QXH7 4.64e-07 54 27 4 183 3 fadB Fatty acid oxidation complex subunit alpha Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A7N1D2 4.65e-07 54 22 3 215 3 fadB Fatty acid oxidation complex subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
Q1R466 4.66e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain UTI89 / UPEC)
B7MHD1 4.66e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O45:K1 (strain S88 / ExPEC)
A7MQP0 4.7e-07 54 24 2 194 3 fadB Fatty acid oxidation complex subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
Q1I7D4 4.8e-07 54 24 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas entomophila (strain L48)
B7UNH4 4.83e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A6TC19 4.85e-07 54 24 4 211 3 fadJ Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XYH0 5.01e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae (strain 342)
A6V382 5.5e-07 54 23 4 221 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain PA7)
B7N2F2 5.58e-07 54 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O81 (strain ED1a)
A4Y897 6.22e-07 53 27 4 193 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6TGM4 6.57e-07 53 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q9HZJ2 6.59e-07 53 23 4 221 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PH8 6.59e-07 53 23 4 221 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UYR6 6.59e-07 53 23 4 221 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain LESB58)
Q87TN9 6.61e-07 53 22 4 220 3 fadB Fatty acid oxidation complex subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6NMB0 6.91e-07 53 23 5 214 2 At2g30660 Probable 3-hydroxyisobutyryl-CoA hydrolase 3 Arabidopsis thaliana
Q0HKD1 7.07e-07 53 26 4 196 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-4)
Q0HWN3 7.53e-07 53 26 4 196 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-7)
A6WQ25 8.16e-07 53 26 4 193 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS185)
A1S7L6 8.23e-07 53 26 6 192 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q4KFC4 8.41e-07 53 25 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8BMS1 8.49e-07 53 24 4 202 1 Hadha Trifunctional enzyme subunit alpha, mitochondrial Mus musculus
P42125 8.98e-07 52 25 3 176 1 Eci1 Enoyl-CoA delta isomerase 1, mitochondrial Mus musculus
Q8ECP7 9.17e-07 53 26 4 196 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B2TVJ5 9.52e-07 53 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1IW61 9.52e-07 53 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7M649 9.52e-07 53 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O8 (strain IAI1)
B7L9A7 9.52e-07 53 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain 55989 / EAEC)
Q3YVC1 1.1e-06 53 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Shigella sonnei (strain Ss046)
P21177 1.1e-06 53 24 4 218 1 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12)
B1XAK8 1.1e-06 53 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / DH10B)
C5A020 1.1e-06 53 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / MC4100 / BW2952)
A4WFX4 1.13e-06 53 23 3 218 3 fadB Fatty acid oxidation complex subunit alpha Enterobacter sp. (strain 638)
A7FDF2 1.31e-06 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7ZU51 1.31e-06 53 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O139:H28 (strain E24377A / ETEC)
F1R6N4 1.34e-06 52 27 4 177 3 echdc1 Ethylmalonyl-CoA decarboxylase Danio rerio
B7LTY9 1.38e-06 53 24 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B4TNZ1 1.4e-06 53 26 2 176 3 fadB Fatty acid oxidation complex subunit alpha Salmonella schwarzengrund (strain CVM19633)
Q66FR8 1.43e-06 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K0Z6 1.43e-06 53 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JP63 1.45e-06 52 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TR27 1.45e-06 52 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis (strain Pestoides F)
Q1CN99 1.45e-06 52 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Nepal516)
A9R754 1.45e-06 52 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAN0 1.45e-06 52 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis
Q1C2C4 1.45e-06 52 31 4 144 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Antiqua)
Q5E8X6 1.52e-06 52 24 1 135 3 fadB Fatty acid oxidation complex subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q6DAP5 1.62e-06 52 23 3 212 3 fadB Fatty acid oxidation complex subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B7VGL4 1.85e-06 52 25 2 176 3 fadB Fatty acid oxidation complex subunit alpha Vibrio atlanticus (strain LGP32)
O87873 1.88e-06 51 23 10 256 1 dch Cyclohexa-1,5-dienecarbonyl-CoA hydratase Thauera aromatica
Q64428 1.93e-06 52 23 4 202 1 Hadha Trifunctional enzyme subunit alpha, mitochondrial Rattus norvegicus
A8FP63 2.19e-06 52 23 5 197 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sediminis (strain HAW-EB3)
A8GH86 2.31e-06 52 24 5 193 3 fadJ Fatty acid oxidation complex subunit alpha Serratia proteamaculans (strain 568)
C3K613 2.65e-06 52 25 5 225 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fluorescens (strain SBW25)
Q4ZRA0 2.8e-06 52 24 6 222 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas syringae pv. syringae (strain B728a)
P28793 2.84e-06 52 23 4 221 1 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fragi
P28817 2.99e-06 52 26 4 192 1 EHD3 Small ribosomal subunit protein mS47 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B4SZ85 3.55e-06 51 24 5 218 3 fadB Fatty acid oxidation complex subunit alpha Salmonella newport (strain SL254)
B6I4I6 3.71e-06 51 23 4 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain SE11)
A9MYB0 3.75e-06 51 24 2 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57HM6 3.75e-06 51 24 2 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella choleraesuis (strain SC-B67)
B5EZW0 3.88e-06 51 24 2 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella agona (strain SL483)
Q9L6L5 3.99e-06 51 24 2 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0KV76 4.03e-06 51 26 4 196 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain ANA-3)
B5RFL6 4.06e-06 51 24 2 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW85 4.06e-06 51 24 2 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella enteritidis PT4 (strain P125109)
Q8Z3C6 4.17e-06 51 24 2 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella typhi
Q87ZB2 4.2e-06 51 22 4 221 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A1S1I8 4.23e-06 51 23 4 198 3 fadB Fatty acid oxidation complex subunit alpha Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B5BIZ0 4.36e-06 51 24 2 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain AKU_12601)
Q5PKQ2 4.36e-06 51 24 2 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9KT58 4.41e-06 51 29 1 104 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2P2 4.74e-06 51 29 1 104 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87MM3 5.17e-06 51 23 3 176 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LTK3 5.39e-06 51 24 5 183 3 fadJ Fatty acid oxidation complex subunit alpha Photobacterium profundum (strain SS9)
A8ACZ4 5.47e-06 51 23 4 221 3 fadB Fatty acid oxidation complex subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2I2J9 5.64e-06 51 25 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain ACICU)
B0VLX4 5.8e-06 51 25 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain SDF)
B0VE45 5.85e-06 51 25 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain AYE)
B7I3P1 5.85e-06 51 25 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain AB0057)
B7H1I0 5.85e-06 51 25 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain AB307-0294)
Q9AHY3 6.75e-06 50 23 6 235 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida
B5FEW8 7.28e-06 50 22 1 135 3 fadB Fatty acid oxidation complex subunit alpha Aliivibrio fischeri (strain MJ11)
Q7MIS5 7.29e-06 50 23 3 180 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain YJ016)
Q3K9D8 8.22e-06 50 23 4 221 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fluorescens (strain Pf0-1)
B1J5A5 8.84e-06 50 23 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain W619)
Q6FF68 9.08e-06 50 24 3 193 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9F0Y7 1.12e-05 50 23 4 218 3 fadB Fatty acid oxidation complex subunit alpha Enterobacter cloacae
Q8DB47 1.13e-05 50 23 3 180 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain CMCP6)
A7MS61 1.32e-05 50 22 3 176 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
A4VKA3 1.42e-05 50 23 5 230 3 fadB Fatty acid oxidation complex subunit alpha Stutzerimonas stutzeri (strain A1501)
A5W6H0 1.54e-05 49 23 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q48GW3 1.63e-05 49 22 4 221 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A8GYG0 1.97e-05 49 24 5 219 3 fadB Fatty acid oxidation complex subunit alpha Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0KH74 2.13e-05 49 23 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain GB-1)
Q93Q12 2.23e-05 49 23 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas oleovorans
B8CH91 2.62e-05 48 21 3 196 3 fadB Fatty acid oxidation complex subunit alpha Shewanella piezotolerans (strain WP3 / JCM 13877)
Q489W3 2.87e-05 48 22 2 190 3 fadB Fatty acid oxidation complex subunit alpha Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q88L02 3.49e-05 48 23 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P23965 4.56e-05 47 25 3 176 1 Eci1 Enoyl-CoA delta isomerase 1, mitochondrial Rattus norvegicus
B0TLB9 5.87e-05 48 24 6 219 3 fadB Fatty acid oxidation complex subunit alpha Shewanella halifaxensis (strain HAW-EB4)
Q5E3U1 0.000103 47 24 3 145 3 fadJ Fatty acid oxidation complex subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
A5F465 0.000281 45 21 2 194 3 fadB Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LSI3 0.000312 45 21 2 194 3 fadB Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain M66-2)
Q9KNI1 0.000312 45 21 2 194 3 fadB Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P40939 0.000792 44 30 1 88 1 HADHA Trifunctional enzyme subunit alpha, mitochondrial Homo sapiens

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_05735
Feature type CDS
Gene menB
Product 1,4-dihydroxy-2-naphthoyl-CoA synthase
Location 147692 - 148549 (strand: -1)
Length 858 (nucleotides) / 285 (amino acids)

Contig

Accession ZDB_362
Length 257361 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_374
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00378 Enoyl-CoA hydratase/isomerase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0447 Coenzyme transport and metabolism (H) H 1,4-Dihydroxy-2-naphthoyl-CoA synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MMYPSEEKLSAPVEWVDCTGDYQDILFHKSKDGIAKITINRPQVRNAFRPLTVKEMISALANARYDDGIGTIIFTGQGEKAFCAGGDQKIRGDYGGYRDDSGTHHLNVLDLQRDIRTCPKPVVAMVAGYAIGGGHVLHMICDLTIAADNAVFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYNAQEALDMGLVNTVVPYADLEKETVRWCREMLENSPMALRCLKAALNADCDGQSGLQELAGNATMLFYMTEEGQEGRNAFNEKRSPDFSKFKRNP

Flanking regions ( +/- flanking 50bp)

GACAGTCCGGACATTTTTATCATTACATTCTGTTTAAGGAACTCACCGCTATGATGTATCCGAGCGAAGAAAAGCTCTCTGCCCCGGTTGAATGGGTCGACTGCACCGGCGATTATCAGGATATTCTGTTTCATAAATCAAAAGACGGTATCGCCAAAATCACTATTAACCGTCCGCAGGTGCGCAACGCGTTCCGTCCGTTAACAGTGAAAGAGATGATCAGTGCGCTGGCGAATGCCCGTTATGATGACGGCATCGGCACCATTATTTTTACCGGGCAGGGCGAAAAAGCCTTCTGTGCGGGCGGTGACCAGAAAATCCGCGGTGACTACGGCGGCTACCGTGATGACAGCGGCACTCATCATCTGAATGTGCTGGATTTACAGCGCGATATCCGTACCTGTCCGAAGCCGGTGGTGGCGATGGTGGCGGGGTATGCTATCGGCGGCGGCCATGTGCTGCACATGATTTGTGACCTGACCATTGCGGCGGATAATGCGGTATTCGGCCAGACCGGGCCGAAAGTCGGTTCATTTGACGGCGGCTGGGGTGCTTCTTATATGGCGCGGATTGTCGGCCAGAAGAAAGCCCGTGAAATCTGGTTCCTGTGCCGTCAGTACAATGCACAGGAAGCGCTGGATATGGGACTGGTCAACACCGTGGTGCCTTACGCGGATCTGGAAAAAGAAACCGTGCGCTGGTGCCGTGAGATGCTGGAAAACAGTCCGATGGCGCTGCGCTGCCTGAAAGCGGCACTCAATGCGGATTGTGACGGCCAGTCCGGTCTGCAGGAGCTGGCGGGTAATGCCACCATGCTGTTCTACATGACCGAAGAAGGTCAGGAAGGGCGTAATGCATTCAACGAAAAACGCTCACCGGATTTCTCTAAATTCAAACGTAACCCGTAATGCGCCACGCCACACTGTACAGTTTCAGCCTGCCGATGGAGGCAGGCGTT