Homologs in group_374

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14075 FBDBKF_14075 90.5 Morganella morganii S1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
EHELCC_08205 EHELCC_08205 90.5 Morganella morganii S2 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
NLDBIP_08530 NLDBIP_08530 90.5 Morganella morganii S4 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
LHKJJB_05735 LHKJJB_05735 90.5 Morganella morganii S3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
HKOGLL_05180 HKOGLL_05180 90.5 Morganella morganii S5 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
F4V73_RS02860 F4V73_RS02860 89.5 Morganella psychrotolerans menB 1,4-dihydroxy-2-naphthoyl-CoA synthase
PMI_RS13095 PMI_RS13095 30.6 Proteus mirabilis HI4320 caiD crotonobetainyl-CoA hydratase

Distribution of the homologs in the orthogroup group_374

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_374

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABU0 0.0 554 90 0 285 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Escherichia coli (strain K12)
P0ABU1 0.0 554 90 0 285 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7CQ56 0.0 549 89 0 285 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9CLV5 0.0 536 87 0 285 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Pasteurella multocida (strain Pm70)
P44960 0.0 525 84 0 285 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23966 9.96e-137 389 68 3 272 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Bacillus subtilis (strain 168)
Q49WG8 1.56e-130 374 66 3 272 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L549 7.47e-130 372 66 3 272 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus haemolyticus (strain JCSC1435)
Q5HQC3 8.07e-130 372 65 3 272 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CPQ4 2.38e-129 371 65 3 272 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8NXA0 1.85e-128 369 64 3 272 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain MW2)
Q6GAG7 1.85e-128 369 64 3 272 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain MSSA476)
Q6GI37 2.33e-128 369 64 3 272 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain MRSA252)
Q5HH38 2.33e-128 369 64 3 272 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain COL)
Q7A6A9 3.56e-128 368 64 3 272 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain N315)
Q99V48 3.56e-128 368 64 3 272 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8GYN9 7.16e-127 367 66 2 265 1 MENB 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal Arabidopsis thaliana
Q9TM10 9.44e-116 336 61 2 260 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Cyanidium caldarium
A0QRD3 9.25e-78 241 46 8 304 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WNP5 1.15e-77 241 47 5 285 1 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNP4 1.15e-77 241 47 5 285 3 menB 1,4-dihydroxy-2-naphthoyl-CoA synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A4YI89 1.08e-34 129 34 4 244 1 Msed_2001 3-hydroxypropionyl-coenzyme A dehydratase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
P52046 4.99e-34 127 33 4 251 1 crt Short-chain-enoyl-CoA hydratase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P9WNN9 2.71e-33 125 36 6 261 1 echA8 Probable enoyl-CoA hydratase EchA8 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN8 2.71e-33 125 36 6 261 3 echA8 Probable enoyl-CoA hydratase echA8 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64017 2.71e-33 125 36 6 261 3 echA8 Probable enoyl-CoA hydratase echA8 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P30084 4.6e-33 125 33 7 271 1 ECHS1 Enoyl-CoA hydratase, mitochondrial Homo sapiens
Q0AVM1 5.91e-33 124 33 5 262 1 Swol_1936 Crotonyl-CoA hydratase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P14604 6.23e-32 122 35 5 245 1 Echs1 Enoyl-CoA hydratase, mitochondrial Rattus norvegicus
Q5R646 9e-32 122 33 7 271 2 ECHS1 Enoyl-CoA hydratase, mitochondrial Pongo abelii
Q8BH95 1.35e-31 121 34 5 245 1 Echs1 Enoyl-CoA hydratase, mitochondrial Mus musculus
O07137 1.77e-31 120 35 6 255 3 echA8 Probable enoyl-CoA hydratase echA8 Mycobacterium leprae (strain TN)
Q1ZXF1 2.49e-31 120 33 5 245 3 echs1 Probable enoyl-CoA hydratase, mitochondrial Dictyostelium discoideum
Q58DM8 5.63e-31 120 32 6 276 2 ECHS1 Enoyl-CoA hydratase, mitochondrial Bos taurus
O34893 1.16e-30 118 31 5 258 3 yngF Putative enoyl-CoA hydratase/isomerase YngF Bacillus subtilis (strain 168)
Q5SKU3 2.29e-30 117 33 7 251 1 TTHA0550 Putative enoyl-CoA hydratase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P34559 5.81e-30 117 32 4 248 3 ech-6 Probable enoyl-CoA hydratase, mitochondrial Caenorhabditis elegans
G4V4T7 8.61e-30 116 32 7 273 1 dpgD Enoyl-CoA-hydratase Amycolatopsis orientalis
O69762 1.1e-29 116 35 4 210 1 None Hydroxycinnamoyl-CoA hydratase-lyase Pseudomonas fluorescens
Q3TLP5 1.75e-29 116 30 4 256 1 Echdc2 Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Mus musculus
Q9KJE7 5.22e-29 114 30 5 255 1 bbsH (E)-benzylidenesuccinyl-CoA hydratase Thauera aromatica
Q2TBT3 1.2e-27 111 31 5 256 2 ECHDC2 Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Bos taurus
Q86YB7 1.13e-26 108 30 5 254 1 ECHDC2 Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Homo sapiens
P76082 1.19e-26 107 30 4 244 1 paaF 2,3-dehydroadipyl-CoA hydratase Escherichia coli (strain K12)
Q52995 2.88e-26 107 33 5 245 3 fadB1 Probable enoyl-CoA hydratase Rhizobium meliloti (strain 1021)
Q4PEN0 4.83e-26 106 28 6 263 1 fer4 Enoyl-CoA isomerase/hydratase fer4 Ustilago maydis (strain 521 / FGSC 9021)
F4JML5 6.73e-25 104 27 5 254 2 At4g16800 Probable enoyl-CoA hydratase 2, mitochondrial Arabidopsis thaliana
Q39TV7 9.35e-25 105 34 1 173 1 bamA 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P52045 1.66e-23 99 29 4 254 1 scpB Methylmalonyl-CoA decarboxylase Escherichia coli (strain K12)
Q96DC8 2.11e-23 100 32 6 250 1 ECHDC3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Homo sapiens
O53561 3.88e-23 98 29 5 248 1 echA19 Enoyl-CoA hydratase EchA19 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q73VC7 1.66e-22 96 30 4 207 3 echA17 Probable enoyl-CoA hydratase echA17 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QJH8 1.73e-22 96 30 4 207 3 echA17 Probable enoyl-CoA hydratase echA17 Mycobacterium avium (strain 104)
A5JTM5 2.61e-22 96 34 4 208 1 None 4-chlorobenzoyl coenzyme A dehalogenase Pseudomonas sp. (strain CBS-3)
A8ALR7 5.39e-22 95 29 4 248 3 caiD Carnitinyl-CoA dehydratase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
O87872 1.36e-21 96 31 1 171 1 oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Thauera aromatica
P9WNP1 1.68e-21 94 29 6 250 1 echA6 Probable enoyl-CoA hydratase EchA6 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNP0 1.68e-21 94 29 6 250 3 echA6 Probable enoyl-CoA hydratase echA6 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64015 1.68e-21 94 29 6 250 3 echA6 Probable enoyl-CoA hydratase echA6 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9D7J9 2.41e-21 94 29 4 262 1 Echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Mus musculus
Q8XA35 3.01e-21 93 32 2 200 3 caiD Carnitinyl-CoA dehydratase Escherichia coli O157:H7
P59395 3.37e-21 93 32 2 200 3 caiD Carnitinyl-CoA dehydratase Shigella flexneri
Q3MIE0 3.51e-21 94 30 5 250 2 Echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Rattus norvegicus
Q8GB17 3.51e-21 93 27 6 269 1 caiD Carnitinyl-CoA dehydratase Proteus sp. (strain LE138)
B4EY26 3.51e-21 93 27 6 269 3 caiD Carnitinyl-CoA dehydratase Proteus mirabilis (strain HI4320)
B1LFW9 3.59e-21 93 32 3 207 3 caiD Carnitinyl-CoA dehydratase Escherichia coli (strain SMS-3-5 / SECEC)
P31551 3.66e-21 93 32 2 200 1 caiD Carnitinyl-CoA dehydratase Escherichia coli (strain K12)
B1IRE0 3.66e-21 93 32 2 200 3 caiD Carnitinyl-CoA dehydratase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FLA6 5.13e-21 92 32 2 200 3 caiD Carnitinyl-CoA dehydratase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLV3 5.13e-21 92 32 2 200 3 caiD Carnitinyl-CoA dehydratase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P9WNN3 5.18e-21 92 29 4 206 1 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN2 5.18e-21 92 29 4 206 3 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U753 5.18e-21 92 29 4 206 3 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1KN36 5.18e-21 92 29 4 206 3 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7TXE1 5.18e-21 92 29 4 206 1 echA17 Probable enoyl-CoA hydratase EchA17 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8Z9L5 1.64e-20 91 28 5 255 3 caiD Carnitinyl-CoA dehydratase Salmonella typhi
B5RGA4 1.9e-20 91 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1Q9 1.9e-20 91 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella enteritidis PT4 (strain P125109)
A9MR28 2.1e-20 91 28 5 259 3 caiD Carnitinyl-CoA dehydratase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8ZRX5 2.19e-20 91 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TWR3 2.19e-20 91 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella schwarzengrund (strain CVM19633)
B4TIG9 2.19e-20 91 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella heidelberg (strain SL476)
B4T6J5 2.37e-20 91 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella newport (strain SL254)
B5BL54 2.58e-20 90 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi A (strain AKU_12601)
C0Q4L2 2.58e-20 90 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi C (strain RKS4594)
Q5PIL1 2.58e-20 90 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57TJ1 2.58e-20 90 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella choleraesuis (strain SC-B67)
B5F749 2.58e-20 90 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella agona (strain SL483)
Q6NL24 2.82e-20 90 31 9 230 1 ECHIA Probable enoyl-CoA hydratase 1, peroxisomal Arabidopsis thaliana
Q7U004 3.54e-20 91 30 5 255 3 echA12 Probable enoyl-CoA hydratase echA12 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A9MYJ5 3.68e-20 90 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5FHG4 3.68e-20 90 28 4 248 3 caiD Carnitinyl-CoA dehydratase Salmonella dublin (strain CT_02021853)
P9WNN7 5.69e-20 90 30 5 255 1 echA12 Probable enoyl-CoA hydratase EchA12 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN6 5.69e-20 90 30 5 255 3 echA12 Probable enoyl-CoA hydratase echA12 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q4WF54 1.26e-19 89 29 6 255 1 sidH Mevalonyl-coenzyme A hydratase sidH Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A0R4Q3 1.4e-19 89 27 6 249 3 echA19 Enoyl-CoA hydratase EchA19 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9WUR2 1.57e-19 90 29 4 212 1 Eci2 Enoyl-CoA delta isomerase 2 Mus musculus
A9JS71 1.67e-19 89 28 9 263 2 echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Xenopus laevis
O75521 2.47e-19 90 30 4 220 1 ECI2 Enoyl-CoA delta isomerase 2 Homo sapiens
F9XMX6 6.56e-19 87 26 7 265 3 MYCGRDRAFT_76805 Enoyl-CoA isomerase/hydratase MYCGRDRAFT_76805 Zymoseptoria tritici (strain CBS 115943 / IPO323)
Q78JN3 6.69e-19 88 30 4 212 1 Eci3 Enoyl-CoA delta isomerase 3, peroxisomal Mus musculus
Q8DSN0 7.54e-19 87 28 6 264 3 fabM Trans-2-decenoyl-[acyl-carrier-protein] isomerase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9JLZ3 1.63e-18 87 30 5 253 1 Auh Methylglutaconyl-CoA hydratase, mitochondrial Mus musculus
Q54HG7 2.33e-18 86 24 5 249 3 auh Methylglutaconyl-CoA hydratase, mitochondrial Dictyostelium discoideum
Q9LCU3 2.41e-18 85 31 5 212 1 fcbB2 4-chlorobenzoyl coenzyme A dehalogenase-2 Arthrobacter sp.
A0PJR5 3.74e-18 85 29 7 250 2 echdc3 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial Danio rerio
O85078 4.28e-18 85 31 5 212 1 fcbB1 4-chlorobenzoyl coenzyme A dehalogenase-1 Arthrobacter sp.
Q2LXU2 5.06e-18 86 27 2 186 1 bamA 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Syntrophus aciditrophicus (strain SB)
Q589W8 6.91e-18 85 29 6 252 3 ACTT3 Enoyl-CoA hydratase ACTT3 Alternaria alternata
F1LU71 1.04e-17 84 30 5 253 1 Auh Methylglutaconyl-CoA hydratase, mitochondrial Rattus norvegicus
Q50130 1.17e-17 83 27 6 253 3 echA6 Probable enoyl-CoA hydratase echA6 Mycobacterium leprae (strain TN)
Q9P4U9 1.85e-17 84 29 6 257 3 AKT3-1 Enoyl-CoA hydratase AKT3-1 Alternaria alternata
P77467 2.2e-17 82 29 7 268 1 paaG 1,2-epoxyphenylacetyl-CoA isomerase Escherichia coli (strain K12)
P53526 3.66e-17 82 33 4 175 3 echA12 Probable enoyl-CoA hydratase echA12 Mycobacterium leprae (strain TN)
Q9P4U7 4.32e-17 82 29 6 257 3 AKT3-2 Enoyl-CoA hydratase AKT3-2 Alternaria alternata
Q5XIC0 6.46e-17 83 30 4 188 1 Eci2 Enoyl-CoA delta isomerase 2 Rattus norvegicus
Q13825 6.55e-17 82 29 5 253 1 AUH Methylglutaconyl-CoA hydratase, mitochondrial Homo sapiens
A0A481WNM8 1.01e-16 83 26 6 261 3 claC Enoyl-CoA isomerase/hydratase claC Penicillium crustosum
P94549 1.11e-16 80 30 6 250 2 fadB Probable enoyl-CoA hydratase Bacillus subtilis (strain 168)
Q96VB3 6.3e-16 79 29 6 257 3 AFT3-1 Enoyl-CoA hydratase AFT3-1 Alternaria alternata
Q54SS0 7.79e-16 79 28 8 260 3 ech1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Dictyostelium discoideum
Q9Y6F8 1.62e-15 79 27 6 240 1 CDY1 Testis-specific chromodomain protein Y 1 Homo sapiens
Q9FHR8 2.34e-15 77 26 6 272 1 DCI1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal Arabidopsis thaliana
Q39659 3.82e-15 79 30 3 193 1 None Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a Cucumis sativus
Q9XB60 6.3e-15 75 26 3 218 1 carB Carboxymethylproline synthase Pectobacterium carotovorum subsp. carotovorum
P45361 9.66e-15 73 34 3 153 3 crt Short-chain-enoyl-CoA hydratase (Fragment) Clostridioides difficile
Q9Y6F7 1.04e-14 77 27 6 240 1 CDY2A Testis-specific chromodomain protein Y 2 Homo sapiens
Q5ZJ60 1.65e-14 76 30 2 155 2 HIBCH 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Gallus gallus
P95279 2.18e-14 75 27 6 243 2 echA13 Putative enoyl-CoA hydratase EchA13 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q55GS6 3.12e-14 75 30 4 165 3 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Dictyostelium discoideum
P41942 4.06e-14 73 26 2 197 3 B0272.4 Uncharacterized protein B0272.4 Caenorhabditis elegans
Q0S7P8 1.9e-13 72 29 6 207 1 echA20 (7aS)-7a-methyl-1,5-dioxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA hydrolase Rhodococcus jostii (strain RHA1)
Q5RFG0 2.23e-13 72 28 9 239 2 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Pongo abelii
Q1K7A4 2.93e-13 73 27 3 179 1 ehd3 Small ribosomal subunit protein mS47 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q13011 4.03e-13 72 28 9 239 1 ECH1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Homo sapiens
P24162 4.81e-13 70 30 9 271 3 fadB1 Probable enoyl-CoA hydratase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q9D5D8 4.9e-13 72 27 5 236 1 Cdyl2 Chromodomain Y-like protein 2 Mus musculus
Q6AYK9 5.05e-13 72 26 8 275 1 Cdyl Chromodomain Y-like protein Rattus norvegicus
Q9WTK2 5.17e-13 72 26 4 234 1 Cdyl Chromodomain Y-like protein Mus musculus
Q8N8U2 5.76e-13 72 27 5 236 1 CDYL2 Chromodomain Y-like protein 2 Homo sapiens
Q5LLW6 6.46e-13 70 24 5 214 1 dmdD Methylthioacryloyl-CoA hydratase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A2VDC2 7.23e-13 71 31 2 148 2 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Xenopus laevis
Q8DR19 1e-12 70 27 6 265 1 fabM Trans-2-decenoyl-[acyl-carrier-protein] isomerase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q8QZS1 1.92e-12 70 29 3 161 1 Hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Mus musculus
B1IXA5 3.68e-12 70 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1LME7 4.07e-12 69 26 6 235 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain SMS-3-5 / SECEC)
Q8XCP2 4.31e-12 69 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7
Q9Y232 4.69e-12 69 25 5 248 1 CDYL Chromodomain Y-like protein Homo sapiens
Q6NVY1 4.73e-12 68 27 3 161 1 HIBCH 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Homo sapiens
B7NP24 5.33e-12 69 25 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q3YZM2 5.73e-12 69 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Shigella sonnei (strain Ss046)
Q83QQ0 5.73e-12 69 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Shigella flexneri
Q0T2E6 5.9e-12 69 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Shigella flexneri serotype 5b (strain 8401)
A8A2L0 6.53e-12 69 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O9:H4 (strain HS)
B5YXY4 6.65e-12 69 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7 (strain EC4115 / EHEC)
B7LBJ5 7.29e-12 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain 55989 / EAEC)
B7M6M2 7.85e-12 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O8 (strain IAI1)
B2TWV4 8.45e-12 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I6Q4 8.53e-12 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain SE11)
A7ZPF8 8.85e-12 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O139:H28 (strain E24377A / ETEC)
Q5XIE6 1.14e-11 67 29 4 168 1 Hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Rattus norvegicus
Q1R972 1.18e-11 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain UTI89 / UPEC)
A1ADI8 1.18e-11 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O1:K1 / APEC
Q32DJ4 1.2e-11 68 25 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Shigella dysenteriae serotype 1 (strain Sd197)
Q869N6 1.28e-11 67 26 8 267 3 DDB_G0271866 3-hydroxybutyryl-CoA dehydratase-like protein, mitochondrial Dictyostelium discoideum
Q58EB4 1.29e-11 67 28 4 169 2 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Danio rerio
B7UFZ8 1.29e-11 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7MY16 1.3e-11 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O81 (strain ED1a)
B7MGV7 1.36e-11 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0TFA6 1.44e-11 68 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N5V2 1.75e-11 67 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q31YB7 1.97e-11 67 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Shigella boydii serotype 4 (strain Sb227)
Q8FFG4 2.2e-11 67 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q08426 2.36e-11 67 29 7 206 1 EHHADH Peroxisomal bifunctional enzyme Homo sapiens
Q62651 2.54e-11 66 27 8 210 1 Ech1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Rattus norvegicus
O35459 3.19e-11 66 27 7 211 1 Ech1 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial Mus musculus
Q6NYL3 3.63e-11 67 31 6 174 2 ehhadh Peroxisomal bifunctional enzyme Danio rerio
A8ADP2 3.8e-11 67 25 4 212 3 fadJ Fatty acid oxidation complex subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q28FR6 4.94e-11 65 30 2 148 2 hibch 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Xenopus tropicalis
V5XZU2 5.18e-11 65 28 5 191 3 AKT6-1 Enoyl-CoA hydratase AKT6-1 Alternaria alternata
Q2HJD5 5.28e-11 65 22 3 218 2 ECHDC1 Ethylmalonyl-CoA decarboxylase Bos taurus
P40802 5.83e-11 64 27 4 200 1 pksI Putative polyketide biosynthesis enoyl-CoA isomerase PksI Bacillus subtilis (strain 168)
Q6LW06 6.2e-11 66 26 2 192 3 fadB Fatty acid oxidation complex subunit alpha Photobacterium profundum (strain SS9)
Q5R5M8 6.44e-11 66 29 7 206 2 EHHADH Peroxisomal bifunctional enzyme Pongo abelii
P77399 7.09e-11 66 24 5 230 1 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12)
B1X9L4 7.09e-11 66 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / DH10B)
C4ZVN2 7.09e-11 66 24 5 230 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / MC4100 / BW2952)
B5BBA1 8.69e-11 65 25 4 204 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain AKU_12601)
Q5PCX6 8.69e-11 65 25 4 204 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B6EGU2 9.14e-11 65 23 6 221 3 fadB Fatty acid oxidation complex subunit alpha Aliivibrio salmonicida (strain LFI1238)
Q1Q8J9 9.63e-11 65 27 5 198 3 fadB Fatty acid oxidation complex subunit alpha Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7MZ92 1.11e-10 65 25 3 195 3 fadB Fatty acid oxidation complex subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8G8D1 1.11e-10 65 26 3 203 3 fadB Fatty acid oxidation complex subunit alpha Serratia proteamaculans (strain 568)
Q9D9V3 1.15e-10 64 23 5 213 1 Echdc1 Ethylmalonyl-CoA decarboxylase Mus musculus
Q8W1L6 1.2e-10 65 30 2 190 1 MFP Peroxisomal fatty acid beta-oxidation multifunctional protein Oryza sativa subsp. japonica
I6Y3U6 1.28e-10 63 26 4 205 1 echA20 (7aS)-7a-methyl-1,5-dioxo-2,3,5,6,7,7a-hexahydro-1H-indene-carboxyl-CoA hydrolase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P55100 1.3e-10 65 27 7 238 2 EHHADH Peroxisomal bifunctional enzyme Cavia porcellus
Q4FQC6 1.3e-10 65 27 5 194 3 fadB Fatty acid oxidation complex subunit alpha Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
P9WNN5 1.38e-10 63 32 3 176 1 echA14 Probable enoyl-CoA hydratase EchA14 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNN4 1.38e-10 63 32 3 176 3 echA14 Probable enoyl-CoA hydratase echA14 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P64019 1.38e-10 63 32 3 176 1 echA14 Probable enoyl-CoA hydratase echA14 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5R4W0 1.5e-10 63 22 5 224 2 ECHDC1 Ethylmalonyl-CoA decarboxylase Pongo abelii
Q9NTX5 1.59e-10 63 22 5 224 1 ECHDC1 Ethylmalonyl-CoA decarboxylase Homo sapiens
Q5QXM1 1.63e-10 65 28 5 183 3 fadJ Fatty acid oxidation complex subunit alpha Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A3D684 2.65e-10 64 28 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS155 / ATCC BAA-1091)
V5XZU7 2.99e-10 63 27 5 191 3 AFT6-1 Enoyl-CoA hydratase AFT6-1 Alternaria alternata
Q9ZPI6 3.42e-10 63 27 2 201 1 AIM1 Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 Arabidopsis thaliana
Q9DBM2 4.14e-10 63 28 5 196 1 Ehhadh Peroxisomal bifunctional enzyme Mus musculus
Q2HJ73 4.66e-10 63 29 4 162 2 HIBCH 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial Bos taurus
B7LLD0 4.88e-10 63 25 4 212 3 fadJ Fatty acid oxidation complex subunit alpha Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4WCW6 5.45e-10 63 25 5 214 3 fadJ Fatty acid oxidation complex subunit alpha Enterobacter sp. (strain 638)
B5R3R9 5.75e-10 63 23 3 198 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella enteritidis PT4 (strain P125109)
Q5HZQ8 5.87e-10 62 25 5 244 2 echdc1 Ethylmalonyl-CoA decarboxylase Xenopus laevis
B5RCL3 5.91e-10 63 23 4 209 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q8Z4Z0 6.13e-10 63 24 4 204 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella typhi
Q8ZNA7 6.19e-10 63 23 3 198 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4SZR0 6.25e-10 63 23 3 198 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella newport (strain SL254)
B4TCA8 6.25e-10 63 23 3 198 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella heidelberg (strain SL476)
B5FPN1 6.25e-10 63 23 3 198 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella dublin (strain CT_02021853)
B5EZR9 6.25e-10 63 23 3 198 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella agona (strain SL483)
Q57LW6 6.66e-10 63 24 4 204 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella choleraesuis (strain SC-B67)
A9N453 6.72e-10 63 23 3 198 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q7N288 8.27e-10 62 27 3 178 3 fadJ Fatty acid oxidation complex subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
O07533 8.3e-10 61 26 7 249 3 yhaR Putative enoyl-CoA hydratase/isomerase YhaR Bacillus subtilis (strain 168)
B4TQC2 9.01e-10 62 23 3 198 3 fadJ Fatty acid oxidation complex subunit alpha Salmonella schwarzengrund (strain CVM19633)
C5NN19 9.7e-10 61 27 4 173 3 ACTT6 Enoyl-CoA hydratase ACTT6 Alternaria alternata
B0TL21 1.02e-09 62 27 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella halifaxensis (strain HAW-EB4)
A5WH99 1.05e-09 62 25 4 193 3 fadB Fatty acid oxidation complex subunit alpha Psychrobacter sp. (strain PRwf-1)
C6DAL7 1.11e-09 62 24 3 192 3 fadJ Fatty acid oxidation complex subunit alpha Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JK30 1.19e-09 62 37 1 95 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D2L7 1.36e-09 62 25 3 192 3 fadJ Fatty acid oxidation complex subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
O49809 2.06e-09 61 29 3 193 2 None Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a Brassica napus
A0KEL1 2.38e-09 61 24 3 200 3 fadB Fatty acid oxidation complex subunit alpha Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A6WHA0 2.38e-09 61 24 3 193 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS185)
B1KCZ3 2.75e-09 61 26 5 196 3 fadB Fatty acid oxidation complex subunit alpha Shewanella woodyi (strain ATCC 51908 / MS32)
Q8BMS1 2.78e-09 61 25 4 199 1 Hadha Trifunctional enzyme subunit alpha, mitochondrial Mus musculus
Q32A21 3.17e-09 61 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Shigella dysenteriae serotype 1 (strain Sd197)
B8E3R3 3.21e-09 61 24 3 193 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS223)
A6WQ25 3.54e-09 60 27 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS185)
Q07ZP8 3.64e-09 60 26 3 192 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella frigidimarina (strain NCIMB 400)
A3CYJ4 3.69e-09 60 24 3 193 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS155 / ATCC BAA-1091)
A1RI92 3.8e-09 60 27 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain W3-18-1)
Q0HKD1 4.79e-09 60 27 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-4)
Q5E8X6 5.09e-09 60 24 6 220 3 fadB Fatty acid oxidation complex subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
B1LM32 5.24e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain SMS-3-5 / SECEC)
Q0HWN3 5.24e-09 60 27 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-7)
B5YY93 5.59e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X8I2 5.59e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O157:H7
A8A6V1 5.69e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O9:H4 (strain HS)
Q64428 5.99e-09 60 24 4 199 1 Hadha Trifunctional enzyme subunit alpha, mitochondrial Rattus norvegicus
Q8ECP7 6.17e-09 60 27 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q83PG1 6.35e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Shigella flexneri
Q0SZ36 6.35e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Shigella flexneri serotype 5b (strain 8401)
A9KU91 6.49e-09 60 24 3 193 3 fadB Fatty acid oxidation complex subunit alpha Shewanella baltica (strain OS195)
Q1R466 6.71e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain UTI89 / UPEC)
B7MHD1 6.71e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O45:K1 (strain S88 / ExPEC)
Q8EKR9 6.73e-09 60 25 5 222 3 fadB Fatty acid oxidation complex subunit alpha Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B7UNH4 6.89e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4Y897 7.01e-09 60 27 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8FBI2 7.55e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAL0 7.62e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N2F2 7.76e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O81 (strain ED1a)
B7NV20 7.76e-09 60 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7NFE7 8.05e-09 59 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1JIG4 1.21e-08 59 26 3 186 3 fadB Fatty acid oxidation complex subunit alpha Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4TM82 1.22e-08 59 35 1 95 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis (strain Pestoides F)
Q8DDK6 1.27e-08 59 26 5 219 3 fadB Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain CMCP6)
Q1CHK2 1.3e-08 59 35 1 95 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZD45 1.3e-08 59 35 1 95 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis
Q1C660 1.3e-08 59 35 1 95 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Antiqua)
A7FGK1 1.3e-08 59 35 1 95 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7N1D2 1.33e-08 59 24 4 217 3 fadB Fatty acid oxidation complex subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
Q668V1 1.33e-08 59 35 1 95 3 fadJ Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype I (strain IP32953)
A0KR50 1.36e-08 59 24 5 222 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain ANA-3)
Q6AYG5 1.4e-08 58 21 4 223 1 Echdc1 Ethylmalonyl-CoA decarboxylase Rattus norvegicus
B2TVJ5 1.64e-08 58 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1IW61 1.64e-08 58 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7M649 1.64e-08 58 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O8 (strain IAI1)
B7L9A7 1.64e-08 58 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain 55989 / EAEC)
Q08A39 1.69e-08 58 25 5 199 3 fadB Fatty acid oxidation complex subunit alpha Shewanella frigidimarina (strain NCIMB 400)
Q3YVC1 1.71e-08 58 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Shigella sonnei (strain Ss046)
P21177 1.71e-08 58 26 5 218 1 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12)
B1XAK8 1.71e-08 58 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / DH10B)
C5A020 1.71e-08 58 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain K12 / MC4100 / BW2952)
Q87TN9 1.73e-08 58 25 5 226 3 fadB Fatty acid oxidation complex subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5XVW2 1.75e-08 58 25 4 211 3 fadJ Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae (strain 342)
Q0I0T3 1.78e-08 58 23 4 222 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-7)
A7ZU51 1.93e-08 58 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli O139:H28 (strain E24377A / ETEC)
B4TNZ1 1.95e-08 58 26 3 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella schwarzengrund (strain CVM19633)
Q0HPB7 2.05e-08 58 24 5 222 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain MR-4)
G4V4T6 2.36e-08 58 30 10 256 1 dpgC (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase Amycolatopsis orientalis
B7LTY9 2.4e-08 58 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5FEW8 2.72e-08 58 23 6 220 3 fadB Fatty acid oxidation complex subunit alpha Aliivibrio fischeri (strain MJ11)
A0KV76 2.88e-08 58 26 3 190 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella sp. (strain ANA-3)
B4SZ85 2.99e-08 58 27 6 218 3 fadB Fatty acid oxidation complex subunit alpha Salmonella newport (strain SL254)
P07896 3e-08 58 27 6 198 1 Ehhadh Peroxisomal bifunctional enzyme Rattus norvegicus
Q1PEY5 3.04e-08 57 27 4 176 2 At2g30650 Probable 3-hydroxyisobutyryl-CoA hydrolase 2 Arabidopsis thaliana
A1RDW6 3.28e-08 58 24 3 193 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sp. (strain W3-18-1)
A4Y1B6 3.28e-08 58 24 3 193 3 fadB Fatty acid oxidation complex subunit alpha Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B5XYH0 3.55e-08 57 26 5 218 3 fadB Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae (strain 342)
O74802 3.8e-08 57 26 2 160 1 snr1 Small ribosomal subunit protein mS47 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9ZPI5 4.02e-08 57 28 3 192 1 MFP2 Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 Arabidopsis thaliana
A7MH81 4.24e-08 57 24 3 182 3 fadJ Fatty acid oxidation complex subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
A6TGM4 4.26e-08 57 27 5 218 3 fadB Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5BIZ0 4.65e-08 57 26 3 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain AKU_12601)
Q5PKQ2 4.65e-08 57 26 3 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9F0Y7 4.88e-08 57 26 6 227 3 fadB Fatty acid oxidation complex subunit alpha Enterobacter cloacae
Q8Z3C6 5.34e-08 57 26 3 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella typhi
A9MYB0 5.39e-08 57 26 3 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57HM6 5.39e-08 57 26 3 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella choleraesuis (strain SC-B67)
B5RFL6 5.44e-08 57 26 3 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW85 5.44e-08 57 26 3 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella enteritidis PT4 (strain P125109)
Q9L6L5 5.49e-08 57 26 3 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A7MQP0 5.54e-08 57 26 6 227 3 fadB Fatty acid oxidation complex subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
B5EZW0 5.59e-08 57 26 3 193 3 fadB Fatty acid oxidation complex subunit alpha Salmonella agona (strain SL483)
A4WFX4 5.69e-08 57 26 4 218 3 fadB Fatty acid oxidation complex subunit alpha Enterobacter sp. (strain 638)
Q5QXH7 5.77e-08 57 26 4 178 3 fadB Fatty acid oxidation complex subunit alpha Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1S7L6 6.01e-08 57 26 4 186 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8ACZ4 6.18e-08 57 24 4 220 3 fadB Fatty acid oxidation complex subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4STF2 6.25e-08 57 24 3 195 3 fadB Fatty acid oxidation complex subunit alpha Aeromonas salmonicida (strain A449)
A3QFP3 6.4e-08 57 26 4 193 3 fadJ Fatty acid oxidation complex subunit alpha Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B6I4I6 6.47e-08 57 25 5 218 3 fadB Fatty acid oxidation complex subunit alpha Escherichia coli (strain SE11)
P28817 8.86e-08 56 26 3 172 1 EHD3 Small ribosomal subunit protein mS47 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A4XSM8 1.16e-07 56 25 6 225 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas mendocina (strain ymp)
Q4ZRA0 1.22e-07 56 28 5 180 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas syringae pv. syringae (strain B728a)
Q1I7D4 1.22e-07 56 24 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas entomophila (strain L48)
P28793 1.24e-07 56 24 5 233 1 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fragi
Q28C91 1.46e-07 55 23 2 174 2 echdc1 Ethylmalonyl-CoA decarboxylase Xenopus tropicalis
Q4KFC4 1.82e-07 55 24 6 235 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A8FP63 1.82e-07 55 25 5 196 3 fadB Fatty acid oxidation complex subunit alpha Shewanella sediminis (strain HAW-EB3)
Q9SHJ8 1.89e-07 55 27 5 177 1 At1g06550 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 Arabidopsis thaliana
P42125 2.05e-07 54 26 3 176 1 Eci1 Enoyl-CoA delta isomerase 1, mitochondrial Mus musculus
Q7MQH9 2.3e-07 55 26 5 219 3 fadB Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain YJ016)
Q6DAP5 2.45e-07 55 24 3 211 3 fadB Fatty acid oxidation complex subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1J5A5 2.79e-07 55 24 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain W619)
A8GH86 2.87e-07 55 23 3 192 3 fadJ Fatty acid oxidation complex subunit alpha Serratia proteamaculans (strain 568)
F1NB38 3.04e-07 54 23 7 224 3 ECHDC1 Ethylmalonyl-CoA decarboxylase Gallus gallus
F1R6N4 3.09e-07 54 25 3 185 3 echdc1 Ethylmalonyl-CoA decarboxylase Danio rerio
A6TC19 3.41e-07 54 25 6 214 3 fadJ Fatty acid oxidation complex subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7FDF2 3.79e-07 54 25 5 237 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q9LKJ1 3.79e-07 54 26 6 190 1 CHY1 3-hydroxyisobutyryl-CoA hydrolase 1 Arabidopsis thaliana
B1JP63 3.96e-07 54 25 5 237 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TR27 3.96e-07 54 25 5 237 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis (strain Pestoides F)
Q1CN99 3.96e-07 54 25 5 237 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Nepal516)
A9R754 3.96e-07 54 25 5 237 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Angola)
Q8ZAN0 3.96e-07 54 25 5 237 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis
Q1C2C4 3.96e-07 54 25 5 237 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pestis bv. Antiqua (strain Antiqua)
Q6NMB0 4e-07 54 24 4 193 2 At2g30660 Probable 3-hydroxyisobutyryl-CoA hydrolase 3 Arabidopsis thaliana
Q66FR8 4.03e-07 54 25 5 237 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K0Z6 4.03e-07 54 25 5 237 3 fadB Fatty acid oxidation complex subunit alpha Yersinia pseudotuberculosis serotype IB (strain PB1/+)
C3K613 4.05e-07 54 24 6 237 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fluorescens (strain SBW25)
Q9AHY3 4.27e-07 54 24 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida
A5W6H0 4.8e-07 54 24 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A1S1I8 5.26e-07 54 25 6 198 3 fadB Fatty acid oxidation complex subunit alpha Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q87ZB2 5.52e-07 54 25 2 167 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q93Q12 5.6e-07 54 24 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas oleovorans
B0KH74 6.08e-07 53 24 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain GB-1)
Q9HZJ2 7.22e-07 53 25 6 225 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PH8 7.22e-07 53 25 6 225 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UYR6 7.22e-07 53 25 6 225 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain LESB58)
Q9KT58 8.86e-07 53 28 1 110 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2P2 8.86e-07 53 28 1 110 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B8CH91 9.39e-07 53 24 5 196 3 fadB Fatty acid oxidation complex subunit alpha Shewanella piezotolerans (strain WP3 / JCM 13877)
A8GYG0 9.56e-07 53 26 6 217 3 fadB Fatty acid oxidation complex subunit alpha Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3Q8U4 1.01e-06 53 24 5 221 3 fadB Fatty acid oxidation complex subunit alpha Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A4VKA3 1.03e-06 53 25 7 234 3 fadB Fatty acid oxidation complex subunit alpha Stutzerimonas stutzeri (strain A1501)
Q88L02 1.18e-06 53 24 5 223 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3K9D8 1.41e-06 53 23 5 233 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas fluorescens (strain Pf0-1)
Q5E3U1 1.89e-06 52 24 6 195 3 fadJ Fatty acid oxidation complex subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
A6V382 2.04e-06 52 24 6 225 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas aeruginosa (strain PA7)
Q6LTK3 2.19e-06 52 24 3 182 3 fadJ Fatty acid oxidation complex subunit alpha Photobacterium profundum (strain SS9)
B7VGL4 2.28e-06 52 25 2 175 3 fadB Fatty acid oxidation complex subunit alpha Vibrio atlanticus (strain LGP32)
Q87MM3 2.3e-06 52 24 3 176 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q48GW3 2.34e-06 52 25 2 167 3 fadB Fatty acid oxidation complex subunit alpha Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A5F465 2.43e-06 52 23 3 196 3 fadB Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LSI3 2.75e-06 52 23 3 196 3 fadB Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain M66-2)
Q9KNI1 2.75e-06 52 23 3 196 3 fadB Fatty acid oxidation complex subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A7MS61 3.13e-06 52 23 3 180 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
Q7MIS5 3.42e-06 51 28 1 100 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain YJ016)
B0TLB9 3.63e-06 51 26 7 217 3 fadB Fatty acid oxidation complex subunit alpha Shewanella halifaxensis (strain HAW-EB4)
P40805 5.09e-06 50 23 5 171 1 pksH Probable polyketide biosynthesis enoyl-CoA hydratase PksH Bacillus subtilis (strain 168)
Q8DB47 5.37e-06 51 28 1 100 3 fadJ Fatty acid oxidation complex subunit alpha Vibrio vulnificus (strain CMCP6)
Q6FF68 7.87e-06 50 24 3 193 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P23965 9.03e-06 49 26 3 176 1 Eci1 Enoyl-CoA delta isomerase 1, mitochondrial Rattus norvegicus
B2I2J9 1.37e-05 50 24 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain ACICU)
B0VLX4 1.4e-05 50 24 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain SDF)
B0VE45 1.53e-05 49 24 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain AYE)
B7I3P1 1.53e-05 49 24 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain AB0057)
B7H1I0 1.53e-05 49 24 3 176 3 fadB Fatty acid oxidation complex subunit alpha Acinetobacter baumannii (strain AB307-0294)
Q29554 2.07e-05 49 24 3 175 2 HADHA Trifunctional enzyme subunit alpha, mitochondrial Sus scrofa
O87873 4.39e-05 47 22 8 251 1 dch Cyclohexa-1,5-dienecarbonyl-CoA hydratase Thauera aromatica
Q489W3 6.78e-05 47 22 2 189 3 fadB Fatty acid oxidation complex subunit alpha Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
P40939 7.26e-05 47 23 4 178 1 HADHA Trifunctional enzyme subunit alpha, mitochondrial Homo sapiens
P42126 0.000273 45 24 5 181 1 ECI1 Enoyl-CoA delta isomerase 1, mitochondrial Homo sapiens

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS08555
Feature type CDS
Gene menB
Product 1,4-dihydroxy-2-naphthoyl-CoA synthase
Location 1865907 - 1866764 (strand: -1)
Length 858 (nucleotides) / 285 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_374
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00378 Enoyl-CoA hydratase/isomerase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0447 Coenzyme transport and metabolism (H) H 1,4-Dihydroxy-2-naphthoyl-CoA synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MLYPSEEKLYAPIEWQDCSEGFEDILYHKSVDGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDSIGTIILTGAGEKAFCAGGDQKIRGDYGGYRDESGTHHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYNAQEALDMGLVNTVVPYASLEKETVRWCREMLENSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTDEGQEGRNAFNEKRHPDFTKFKRNP

Flanking regions ( +/- flanking 50bp)

CTGCGGTGATAAACCATGTATTATCCCTCTTTGGTTAAAGGAACCTAATTATGCTTTACCCGAGCGAAGAAAAGCTATATGCACCGATTGAATGGCAGGATTGTTCTGAAGGTTTTGAAGATATCCTCTACCACAAATCTGTCGATGGCATTGCCAAAATTACGATTAACCGCCCGCAAGTGCGTAATGCTTTCCGTCCTTTGACTGTGAAAGAGATGATCCAAGCATTAGCCGATGCACGTTACGATGACTCAATTGGTACTATTATTCTTACTGGTGCAGGCGAAAAAGCGTTTTGTGCCGGTGGTGACCAAAAGATCCGGGGTGACTACGGTGGATACCGTGATGAAAGTGGCACTCACCACTTAAACGTATTAGATTTCCAACGCCAAATTCGTACTTGTCCTAAACCTGTTGTTGCTATGGTGGCTGGCTACTCCATTGGTGGTGGTCATGTCTTACATATGATGTGTGATTTAACCATTGCTGCAGACAATGCCATTTTTGGTCAAACTGGTCCTAAAGTAGGCTCATTTGATGGTGGATGGGGTGCTTCTTATATGGCACGTATTGTCGGGCAGAAGAAAGCTCGCGAAATCTGGTTCTTATGCCGCCAATATAATGCGCAAGAAGCATTAGATATGGGATTGGTAAATACCGTTGTTCCTTATGCTTCTCTTGAAAAAGAAACGGTACGTTGGTGTCGTGAAATGCTAGAAAATAGCCCAATGGCACTACGTTGCTTGAAAGCAGCATTAAATGCTGACTGTGATGGTCAAGCGGGTCTGCAAGAATTGGCTGGTAATGCAACCATGCTGTTTTATATGACAGATGAAGGTCAAGAAGGACGTAATGCTTTTAATGAAAAACGTCATCCTGATTTCACTAAATTTAAACGTAACCCATAATGCGAAACGCCAAACTCTATTCATTCAGCCTGCCAATGGAGGCAGGTGTT