Homologs in group_1814

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13450 FBDBKF_13450 100.0 Morganella morganii S1 znuC manganese/iron ABC transporter ATP-binding protein
EHELCC_08645 EHELCC_08645 100.0 Morganella morganii S2 znuC manganese/iron ABC transporter ATP-binding protein
NLDBIP_08970 NLDBIP_08970 100.0 Morganella morganii S4 znuC manganese/iron ABC transporter ATP-binding protein
HKOGLL_05620 HKOGLL_05620 100.0 Morganella morganii S5 znuC manganese/iron ABC transporter ATP-binding protein
F4V73_RS03315 F4V73_RS03315 93.2 Morganella psychrotolerans - manganese/iron ABC transporter ATP-binding protein
PMI_RS04985 PMI_RS04985 82.3 Proteus mirabilis HI4320 - manganese/iron ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_1814

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1814

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q56953 1.24e-165 464 76 0 289 3 yfeB Chelated iron transport system membrane protein YfeB Yersinia pestis
P44662 2.61e-140 400 68 1 276 3 HI_0361 Probable iron transport system ATP-binding protein HI_0361 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q55281 4.87e-107 314 61 0 244 3 mntA Manganese transport system ATP-binding protein MntA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8Y651 1.11e-65 208 44 2 231 3 mntB Manganese transport system ATP-binding protein MntB Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9KD30 2.21e-65 208 44 3 238 3 mntB Manganese transport system ATP-binding protein MntB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q92AF9 6.36e-65 206 43 2 231 3 mntB Manganese transport system ATP-binding protein MntB Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P96117 1.75e-63 204 41 2 252 3 troB Zinc transport system ATP-binding protein TroB Treponema pallidum (strain Nichols)
O34338 1.08e-62 201 43 2 234 2 mntB Manganese transport system ATP-binding protein MntB Bacillus subtilis (strain 168)
P48334 5.78e-54 178 41 2 234 3 None Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region Cyanophora paradoxa
P42360 6.28e-53 176 39 3 234 1 scaC Manganese import ATP-binding protein ScaC Streptococcus gordonii
Q9Z8J5 8.72e-53 176 37 2 231 3 CPn_0348 Probable metal transport system ATP-binding protein CPn_0348/CP_0412/CPj0348/CpB0355 Chlamydia pneumoniae
Q9PKX1 3.98e-52 174 36 2 231 3 TC_0339 Probable metal transport system ATP-binding protein TC_0339 Chlamydia muridarum (strain MoPn / Nigg)
O84071 1.78e-51 172 36 2 231 3 CT_068 Probable metal transport system ATP-binding protein CT_068 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q926D8 8.66e-42 147 40 5 220 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9XDA6 4.17e-40 143 39 5 225 3 zurA Zinc uptake system ATP-binding protein ZurA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q57243 1.6e-35 131 32 5 239 3 HI_1272 Uncharacterized ABC transporter ATP-binding protein HI_1272 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O34946 1.3e-34 128 35 4 207 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
Q92CK1 2.24e-32 123 34 4 234 3 lin1170 Putative ABC transporter ATP-binding protein lin1170 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
O52618 2.7e-32 125 34 4 217 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti (strain 1021)
O34510 3.9e-32 122 32 6 240 3 yfmF Fe(3+)-citrate import ATP-binding protein YfmF Bacillus subtilis (strain 168)
Q9Z810 3.97e-32 122 38 3 213 3 CPn_0542 Probable metal transport system ATP-binding protein CPn_0542/CP_0210/CPj0542/CpB0563 Chlamydia pneumoniae
Q2RZ08 2.01e-31 121 34 7 245 3 hmuV Hemin import ATP-binding protein HmuV Salinibacter ruber (strain DSM 13855 / M31)
Q2NHA1 3.08e-31 120 33 5 231 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q47087 3.56e-31 120 32 5 226 3 cbrD Achromobactin transport ATP-binding protein CbrD Dickeya dadantii (strain 3937)
Q6LTB1 4.98e-31 119 35 5 232 3 znuC Zinc import ATP-binding protein ZnuC Photobacterium profundum (strain SS9)
Q8GNH6 5.01e-31 121 34 4 215 3 nodI Nod factor export ATP-binding protein I Rhizobium meliloti
Q6D4A8 5.02e-31 119 34 5 232 3 znuC Zinc import ATP-binding protein ZnuC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q0VTB6 8.91e-31 119 34 6 239 3 znuC Zinc import ATP-binding protein ZnuC Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3IWB5 1.73e-30 117 36 4 216 3 znuC Zinc import ATP-binding protein ZnuC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8KFD6 1.86e-30 119 33 5 233 3 CT0391 Putative ABC transporter ATP-binding protein CT0391 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P07821 3.07e-30 117 30 5 240 1 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Escherichia coli (strain K12)
Q1CJG3 3.52e-30 117 34 6 257 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CIC2 3.52e-30 117 34 6 257 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis
Q1C812 3.52e-30 117 34 6 257 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pestis bv. Antiqua (strain Antiqua)
Q66AT7 4.58e-30 117 34 6 257 3 znuC Zinc import ATP-binding protein ZnuC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q97JB8 5e-30 117 33 4 247 3 CA_C1368 Putative ABC transporter ATP-binding protein CA_C1368 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9WXX8 5.59e-30 116 31 5 233 3 TM_0124 Probable metal transport system ATP-binding protein TM_0124 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O34362 6.25e-30 121 32 6 252 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
O34362 8.72e-18 86 28 7 254 1 ykoD Putative HMP/thiamine import ATP-binding protein YkoD Bacillus subtilis (strain 168)
Q89C51 6.85e-30 117 34 5 233 3 phnC Phosphonates import ATP-binding protein PhnC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q57399 7.82e-30 116 30 3 233 1 molC Molybdate import ATP-binding protein MolC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q1BWI2 8.94e-30 117 35 4 204 3 nodI Nod factor export ATP-binding protein I Burkholderia orbicola (strain AU 1054)
Q39GT7 1.06e-29 117 34 4 204 3 nodI Nod factor export ATP-binding protein I Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q87RE5 1.09e-29 116 37 4 218 3 znuC Zinc import ATP-binding protein ZnuC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A1JRI2 1.14e-29 115 34 6 232 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q10V16 1.38e-29 115 34 6 241 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Trichodesmium erythraeum (strain IMS101)
Q2FRT7 1.46e-29 119 34 5 239 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
P72335 1.97e-29 116 31 5 226 3 nodI Nod factor export ATP-binding protein I Rhizobium sp. (strain N33)
Q74DN5 2.49e-29 115 34 6 224 3 GSU1281 Putative ABC transporter ATP-binding protein GSU1281 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P49938 2.61e-29 115 35 6 220 3 fhuC Iron(3+)-hydroxamate import ATP-binding protein FhuC Bacillus subtilis (strain 168)
Q3AKM8 4.7e-29 114 33 6 222 3 phnC Phosphonates import ATP-binding protein PhnC Synechococcus sp. (strain CC9605)
P15031 4.71e-29 114 33 6 241 1 fecE Fe(3+) dicitrate transport ATP-binding protein FecE Escherichia coli (strain K12)
Q21PQ7 4.85e-29 114 33 5 217 3 znuC Zinc import ATP-binding protein ZnuC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q81V82 5.45e-29 114 31 4 216 1 fpuD Petrobactin import ATP-binding protein FpuD Bacillus anthracis
Q5UW69 5.68e-29 114 33 4 217 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q72AQ6 5.71e-29 114 33 6 246 3 phnC Phosphonates import ATP-binding protein PhnC Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q3IM24 5.72e-29 114 34 3 216 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q1M7W6 5.93e-29 115 32 5 225 3 nodI Nod factor export ATP-binding protein I Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P23878 8.09e-29 114 31 4 225 1 fepC Ferric enterobactin transport ATP-binding protein FepC Escherichia coli (strain K12)
Q8Y7R4 9.16e-29 114 32 5 237 3 lmo1207 Putative ABC transporter ATP-binding protein lmo1207 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
O69051 1.11e-28 114 34 8 245 3 ptxA Phosphite import ATP-binding protein PxtA Stutzerimonas stutzeri
Q5E6M2 1.15e-28 113 34 5 234 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Aliivibrio fischeri (strain ATCC 700601 / ES114)
P50332 1.29e-28 115 32 4 217 3 nodI Nod factor export ATP-binding protein I Neorhizobium galegae
P0A2U7 1.3e-28 112 33 3 193 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U6 1.3e-28 112 33 3 193 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q720M2 1.46e-28 113 32 5 239 3 LMOf2365_1216 Putative ABC transporter ATP-binding protein LMOf2365_1216 Listeria monocytogenes serotype 4b (strain F2365)
Q748K0 1.55e-28 113 35 5 227 3 GSU3001 Putative ABC transporter ATP-binding protein GSU3001 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A2RI02 1.65e-28 114 34 5 215 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain MG1363)
P23703 1.75e-28 114 31 5 229 3 nodI Nod factor export ATP-binding protein I Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q89AJ0 1.87e-28 112 29 6 235 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8TTN2 1.94e-28 116 33 5 231 3 MA_0394 Putative ABC transporter ATP-binding protein MA_0394 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q0SWH9 2.18e-28 113 31 7 252 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium perfringens (strain SM101 / Type A)
Q160Y9 3.4e-28 112 34 5 232 3 znuC Zinc import ATP-binding protein ZnuC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q0TUN8 3.63e-28 112 31 7 252 1 ecfA3 Energy-coupling factor transporter ATP-binding protein EcfA3 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q58488 3.68e-28 112 32 4 221 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A0KPH6 4.23e-28 112 32 3 235 3 znuC Zinc import ATP-binding protein ZnuC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q3Z2L6 4.26e-28 111 33 5 244 3 znuC Zinc import ATP-binding protein ZnuC Shigella sonnei (strain Ss046)
Q322E8 4.26e-28 111 33 5 244 3 znuC Zinc import ATP-binding protein ZnuC Shigella boydii serotype 4 (strain Sb227)
Q1RAS6 4.26e-28 111 33 5 244 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain UTI89 / UPEC)
P0A9X1 4.26e-28 111 33 5 244 1 znuC Zinc import ATP-binding protein ZnuC Escherichia coli (strain K12)
P0A9X2 4.26e-28 111 33 5 244 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGX4 4.26e-28 111 33 5 244 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AC19 4.26e-28 111 33 5 244 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O1:K1 / APEC
P0A9X3 4.26e-28 111 33 5 244 3 znuC Zinc import ATP-binding protein ZnuC Escherichia coli O157:H7
O27739 4.9e-28 113 33 3 211 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9HT73 4.91e-28 112 35 6 223 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02DK9 4.91e-28 112 35 6 223 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas aeruginosa (strain UCBPP-PA14)
Q32HA3 5.14e-28 111 33 5 244 3 znuC Zinc import ATP-binding protein ZnuC Shigella dysenteriae serotype 1 (strain Sd197)
Q8NQH4 5.18e-28 112 33 6 251 3 phnC Phosphonates import ATP-binding protein PhnC Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9A502 5.41e-28 113 36 3 211 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q032H3 5.73e-28 112 34 4 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. cremoris (strain SK11)
Q7N545 6.19e-28 111 34 5 216 3 znuC Zinc import ATP-binding protein ZnuC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q83KR7 7.19e-28 111 33 5 244 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri
Q0T3U8 7.19e-28 111 33 5 244 3 znuC Zinc import ATP-binding protein ZnuC Shigella flexneri serotype 5b (strain 8401)
Q8UH62 7.21e-28 113 36 4 208 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4ZZS2 9.64e-28 111 34 6 227 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. syringae (strain B728a)
Q8UF79 1.04e-27 112 32 4 224 3 znuC Zinc import ATP-binding protein ZnuC Agrobacterium fabrum (strain C58 / ATCC 33970)
P08720 1.22e-27 112 31 5 225 3 nodI Nod factor export ATP-binding protein I Rhizobium leguminosarum bv. viciae
Q5WDP1 1.47e-27 112 33 2 217 3 metN3 Methionine import ATP-binding protein MetN 3 Shouchella clausii (strain KSM-K16)
Q6FFL0 1.64e-27 110 29 4 237 3 znuC Zinc import ATP-binding protein ZnuC Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q5LUR8 1.74e-27 110 31 5 244 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q2SVP3 1.95e-27 111 33 4 202 3 nodI Nod factor export ATP-binding protein I Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1GMA8 1.99e-27 110 30 6 247 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Ruegeria sp. (strain TM1040)
Q28VL7 2.02e-27 109 36 6 204 3 thiQ Thiamine import ATP-binding protein ThiQ Jannaschia sp. (strain CCS1)
Q88RL1 2.03e-27 110 34 6 228 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1MEG2 2.14e-27 111 31 5 238 3 znuC Zinc import ATP-binding protein ZnuC Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
O57872 2.49e-27 110 36 4 223 3 PH0132 Putative ABC transporter ATP-binding protein PH0132 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P55476 2.6e-27 111 31 5 229 3 nodI Nod factor export ATP-binding protein I Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8FUU5 3e-27 110 33 5 230 3 znuC Zinc import ATP-binding protein ZnuC Brucella suis biovar 1 (strain 1330)
P26050 3.02e-27 110 32 5 220 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3J1N0 4.32e-27 111 34 2 212 3 metN Methionine import ATP-binding protein MetN Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q73P71 5.25e-27 108 29 4 229 3 phnC Phosphonates import ATP-binding protein PhnC Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q50801 5.72e-27 109 33 4 211 3 MTBMA_c05830 Putative ABC transporter ATP-binding protein MTBMA_c05830 Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Q8U3E0 5.79e-27 109 30 5 239 3 PF0528 Putative ABC transporter ATP-binding protein PF0528 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9CIS8 5.91e-27 109 36 4 200 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactococcus lactis subsp. lactis (strain IL1403)
Q28VN1 5.92e-27 108 35 7 234 3 znuC Zinc import ATP-binding protein ZnuC Jannaschia sp. (strain CCS1)
O26236 6.27e-27 109 31 5 225 3 MTH_133 Putative ABC transporter ATP-binding protein MTH_133 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8Z5W6 6.44e-27 108 32 6 244 3 znuC Zinc import ATP-binding protein ZnuC Salmonella typhi
Q5PIA5 6.92e-27 108 32 6 244 3 znuC Zinc import ATP-binding protein ZnuC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57NA5 6.92e-27 108 32 6 244 3 znuC Zinc import ATP-binding protein ZnuC Salmonella choleraesuis (strain SC-B67)
Q8ZNV7 8.71e-27 108 32 6 244 2 znuC Zinc import ATP-binding protein ZnuC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5E882 1.11e-26 107 33 7 221 3 thiQ Thiamine import ATP-binding protein ThiQ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8DIA0 1.18e-26 109 34 5 214 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q3A9G5 1.32e-26 109 32 6 231 3 metN Methionine import ATP-binding protein MetN Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q0BZD8 1.65e-26 107 33 7 233 3 phnC Phosphonates import ATP-binding protein PhnC Hyphomonas neptunium (strain ATCC 15444)
Q6LX68 1.7e-26 108 32 3 216 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P27675 1.81e-26 107 31 3 219 2 glnQ Glutamine transport ATP-binding protein GlnQ Geobacillus stearothermophilus
Q6RCE0 2.27e-26 107 31 9 264 3 phnC Phosphonates import ATP-binding protein PhnC Stutzerimonas stutzeri
Q832Y6 2.53e-26 109 30 5 266 3 metN1 Methionine import ATP-binding protein MetN 1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q8XNY7 2.55e-26 107 30 7 252 3 CPE0195 Putative ABC transporter ATP-binding protein CPE0195 Clostridium perfringens (strain 13 / Type A)
Q7MMN0 2.64e-26 107 33 6 233 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain YJ016)
Q8DFQ4 2.64e-26 107 33 6 233 3 znuC Zinc import ATP-binding protein ZnuC Vibrio vulnificus (strain CMCP6)
Q8NXH5 2.65e-26 108 32 2 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MW2)
Q6GB18 2.65e-26 108 32 2 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MSSA476)
Q5HHK4 2.65e-26 108 32 2 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain COL)
Q2FZZ2 2.65e-26 108 32 2 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FII2 2.65e-26 108 32 2 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain USA300)
Q576K0 2.68e-26 108 33 5 230 3 znuC Zinc import ATP-binding protein ZnuC Brucella abortus biovar 1 (strain 9-941)
Q2YJH4 2.68e-26 108 33 5 230 3 znuC Zinc import ATP-binding protein ZnuC Brucella abortus (strain 2308)
Q9K8N1 2.69e-26 107 28 5 249 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q6GIH9 3.32e-26 108 32 2 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain MRSA252)
Q1LKJ2 3.58e-26 107 30 4 212 3 nodI Nod factor export ATP-binding protein I Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2YWP2 3.79e-26 108 32 2 217 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q63TX3 4.38e-26 107 32 3 202 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain K96243)
Q032D0 4.54e-26 106 29 4 226 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. cremoris (strain SK11)
Q7A6M2 4.56e-26 108 32 2 217 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain N315)
Q99VG8 4.56e-26 108 32 2 217 1 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q3JSQ0 4.66e-26 107 32 3 202 3 nodI Nod factor export ATP-binding protein I Burkholderia pseudomallei (strain 1710b)
Q62K72 4.66e-26 107 32 3 202 3 nodI Nod factor export ATP-binding protein I Burkholderia mallei (strain ATCC 23344)
Q88YN5 5.18e-26 106 29 3 211 3 phnC Phosphonates import ATP-binding protein PhnC Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
O31427 5.6e-26 105 34 5 211 1 skfE SkfA peptide export ATP-binding protein SkfE Bacillus subtilis (strain 168)
Q8YDJ8 6.25e-26 107 32 5 230 3 znuC Zinc import ATP-binding protein ZnuC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P14788 7.71e-26 107 37 4 198 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P74548 7.72e-26 107 31 4 222 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1GL85 7.82e-26 105 33 5 230 3 znuC Zinc import ATP-binding protein ZnuC Ruegeria sp. (strain TM1040)
Q48PV0 8.44e-26 105 34 4 207 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q9RKQ4 8.97e-26 106 34 5 216 3 hmuV Hemin import ATP-binding protein HmuV Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8FYU9 9.07e-26 105 34 10 249 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella suis biovar 1 (strain 1330)
Q8YJ04 9.07e-26 105 34 10 249 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q1IGY7 1.01e-25 105 34 4 204 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas entomophila (strain L48)
Q6WB63 1.1e-25 105 30 7 276 3 phnC Phosphonates import ATP-binding protein PhnC Alcaligenes faecalis
Q98K23 1.13e-25 107 33 3 207 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q57BC2 1.16e-25 105 34 10 249 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella abortus biovar 1 (strain 9-941)
Q2YLW6 1.16e-25 105 34 10 249 3 thiQ Thiamine import ATP-binding protein ThiQ Brucella abortus (strain 2308)
Q8KLG1 1.23e-25 106 30 5 221 3 nodI Nod factor export ATP-binding protein I Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q92VJ2 1.25e-25 107 30 4 260 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q8TIW9 1.31e-25 105 30 6 260 3 MA_4021 Putative ABC transporter ATP-binding protein MA_4021 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q7W025 1.51e-25 105 32 7 249 3 hmuV Hemin import ATP-binding protein HmuV Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q2SPI3 1.71e-25 105 33 6 220 3 znuC1 Zinc import ATP-binding protein ZnuC 1 Hahella chejuensis (strain KCTC 2396)
Q92N13 1.86e-25 105 32 7 241 3 hmuV Hemin import ATP-binding protein HmuV Rhizobium meliloti (strain 1021)
P9WQM1 1.93e-25 106 36 5 213 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 1.93e-25 106 36 5 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 1.93e-25 106 36 5 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q87UN0 1.99e-25 105 33 4 207 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q92P76 2.08e-25 105 31 5 236 3 znuC Zinc import ATP-binding protein ZnuC Rhizobium meliloti (strain 1021)
Q2IYS5 2.11e-25 105 33 7 248 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain HaA2)
Q2W4W1 2.12e-25 104 33 5 227 3 znuC Zinc import ATP-binding protein ZnuC Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q5JEB0 2.17e-25 106 31 6 228 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9Z3I3 2.22e-25 105 32 6 220 3 nodI Nod factor export ATP-binding protein I Bradyrhizobium sp. (strain SNU001)
Q20Y31 2.3e-25 105 30 5 233 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisB18)
A0LCH8 2.31e-25 104 33 4 213 3 znuC Zinc import ATP-binding protein ZnuC Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q9MUN1 2.36e-25 106 33 5 218 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q92XW1 2.45e-25 106 33 3 202 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q9V2E4 2.48e-25 104 34 3 204 3 PYRAB01300 Putative ABC transporter ATP-binding protein PYRAB01300 Pyrococcus abyssi (strain GE5 / Orsay)
Q8Z0H0 2.67e-25 106 34 4 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P94374 2.8e-25 105 32 7 214 2 yxlF Uncharacterized ABC transporter ATP-binding protein YxlF Bacillus subtilis (strain 168)
Q1GJU0 2.87e-25 104 31 7 231 3 hmuV Hemin import ATP-binding protein HmuV Ruegeria sp. (strain TM1040)
Q2SB47 2.9e-25 104 31 5 228 3 hmuV Hemin import ATP-binding protein HmuV Hahella chejuensis (strain KCTC 2396)
Q13ZJ1 3e-25 105 30 5 227 3 nodI Nod factor export ATP-binding protein I Paraburkholderia xenovorans (strain LB400)
Q1R0Z6 3.16e-25 104 31 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q31I51 3.22e-25 104 28 4 238 3 znuC Zinc import ATP-binding protein ZnuC Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8U4L3 3.57e-25 104 33 4 231 3 PF0068 Putative ABC transporter ATP-binding protein PF0068 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q7WEH6 3.68e-25 104 32 7 249 3 hmuV Hemin import ATP-binding protein HmuV Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8UCM5 3.84e-25 104 32 8 236 3 hmuV Hemin import ATP-binding protein HmuV Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2ISN3 4e-25 104 30 5 233 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain HaA2)
Q5YZY9 4.37e-25 105 37 5 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q4KKK4 4.43e-25 103 34 6 217 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8PZN0 4.76e-25 107 29 6 274 3 MM_0462 Putative ABC transporter ATP-binding protein MM_0462 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8K9M6 4.83e-25 103 31 8 253 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q03P57 5.08e-25 105 33 6 239 3 metN Methionine import ATP-binding protein MetN Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q5HQQ9 5.2e-25 105 31 2 218 3 metN2 Methionine import ATP-binding protein MetN 2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P63354 5.67e-25 105 33 3 198 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 5.67e-25 105 33 3 198 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q47MA5 5.77e-25 104 33 5 227 3 hmuV Hemin import ATP-binding protein HmuV Thermobifida fusca (strain YX)
O32188 6.04e-25 103 31 4 213 1 yusV Probable siderophore transport system ATP-binding protein YusV Bacillus subtilis (strain 168)
Q97KD5 6.36e-25 104 33 2 216 3 metN Methionine import ATP-binding protein MetN Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q3KKA1 6.71e-25 103 34 5 207 3 znuC Zinc import ATP-binding protein ZnuC Pseudomonas fluorescens (strain Pf0-1)
Q8CTB2 6.71e-25 105 31 2 218 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8UIW7 6.78e-25 103 31 4 220 3 phnC Phosphonates import ATP-binding protein PhnC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8DWR4 6.99e-25 103 32 5 214 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L3 6.99e-25 103 32 5 214 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF5 6.99e-25 103 32 5 214 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q12R52 7e-25 103 29 8 237 3 hmuV Hemin import ATP-binding protein HmuV Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q63GR8 7.06e-25 105 29 3 247 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q6HP89 7.5e-25 105 29 3 247 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q73EL7 8.22e-25 104 29 3 247 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
A1B9K8 9.16e-25 103 32 3 236 3 znuC Zinc import ATP-binding protein ZnuC Paracoccus denitrificans (strain Pd 1222)
Q9CIQ6 9.24e-25 102 29 4 226 3 phnC Phosphonates import ATP-binding protein PhnC Lactococcus lactis subsp. lactis (strain IL1403)
Q8EB59 9.35e-25 102 33 8 216 3 hmuV Hemin import ATP-binding protein HmuV Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q20ZP0 9.84e-25 103 31 6 264 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisB18)
Q88WA5 1.06e-24 104 31 5 226 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8L1U3 1.08e-24 102 32 7 228 1 hmuV Hemin import ATP-binding protein HmuV Bordetella avium
Q2KUC0 1.08e-24 102 32 7 228 3 hmuV Hemin import ATP-binding protein HmuV Bordetella avium (strain 197N)
Q7W359 1.09e-24 103 32 7 249 3 hmuV Hemin import ATP-binding protein HmuV Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q07LY2 1.24e-24 103 30 5 233 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Rhodopseudomonas palustris (strain BisA53)
Q8TK65 1.26e-24 105 29 6 274 3 MA_3551 Putative ABC transporter ATP-binding protein MA_3551 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q81ZF5 1.35e-24 104 29 3 227 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q4ZU82 1.45e-24 103 30 5 236 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. syringae (strain B728a)
Q7NN36 1.45e-24 102 33 7 234 3 hmuV Hemin import ATP-binding protein HmuV Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q1R155 1.48e-24 102 32 5 225 3 znuC Zinc import ATP-binding protein ZnuC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0AU85 1.51e-24 104 32 3 227 3 metN Methionine import ATP-binding protein MetN Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q6NBX6 1.55e-24 102 29 5 233 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q81IN8 1.67e-24 103 30 2 232 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9KQB8 1.98e-24 102 33 4 213 3 znuC Zinc import ATP-binding protein ZnuC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8RFN2 1.99e-24 103 29 2 227 3 metN Methionine import ATP-binding protein MetN Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q7NIW1 1.99e-24 103 32 4 213 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9RZU5 2.01e-24 102 30 9 263 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q3SGJ8 2.07e-24 102 33 5 226 3 phnC Phosphonates import ATP-binding protein PhnC Thiobacillus denitrificans (strain ATCC 25259)
Q6GKG3 2.35e-24 102 30 6 249 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MRSA252)
Q2K6Q4 2.38e-24 103 32 3 213 3 znuC Zinc import ATP-binding protein ZnuC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2GJA5 2.5e-24 101 31 5 220 3 znuC Zinc import ATP-binding protein ZnuC Anaplasma phagocytophilum (strain HZ)
Q49W48 2.61e-24 103 32 2 210 3 metN Methionine import ATP-binding protein MetN Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q1Q889 2.63e-24 101 31 6 234 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q48HL2 2.79e-24 102 31 5 212 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q16BC5 2.94e-24 102 32 3 216 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q6G475 3.28e-24 101 31 6 234 3 hmuV Hemin import ATP-binding protein HmuV Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q7M8M4 3.55e-24 102 33 7 233 3 phnC Phosphonates import ATP-binding protein PhnC Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q88UV2 3.68e-24 103 33 6 218 3 metN2 Methionine import ATP-binding protein MetN 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q890D1 3.74e-24 100 32 4 204 2 larO Nickel import ATP-binding protein LarO Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q1BJA5 3.93e-24 101 32 7 245 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia orbicola (strain AU 1054)
A0B3E2 3.93e-24 101 32 7 245 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia cenocepacia (strain HI2424)
Q74L61 3.98e-24 102 29 5 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q5KVK2 4.02e-24 103 33 2 208 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q31J97 4.1e-24 101 29 7 236 3 hmuV Hemin import ATP-binding protein HmuV Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8YK28 4.13e-24 101 29 8 258 3 phnC3 Phosphonates import ATP-binding protein PhnC 3 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1LQF6 4.13e-24 103 35 5 222 3 metN Methionine import ATP-binding protein MetN Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q7A1Z1 4.55e-24 101 31 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MW2)
Q6GCY2 4.55e-24 101 31 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain MSSA476)
Q7A848 4.55e-24 101 31 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain N315)
Q99X73 4.55e-24 101 31 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJM6 4.55e-24 101 31 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain COL)
Q2G1L8 4.55e-24 101 31 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKB7 4.55e-24 101 31 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain USA300)
Q3SQ65 4.88e-24 101 28 6 242 3 hmuV Hemin import ATP-binding protein HmuV Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q66FK0 5e-24 101 28 9 273 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CE65 5e-24 101 28 9 273 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Nepal516)
Q56993 5e-24 101 28 9 273 1 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis
Q1C0Q8 5e-24 101 28 9 273 3 hmuV Hemin import ATP-binding protein HmuV Yersinia pestis bv. Antiqua (strain Antiqua)
Q882S0 5.23e-24 101 31 6 217 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C0SPB4 5.61e-24 102 27 8 259 3 yhaQ Uncharacterized ABC transporter ATP-binding protein YhaQ Bacillus subtilis (strain 168)
Q65P76 5.94e-24 101 31 6 225 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3YUN6 6.05e-24 100 30 5 216 3 phnC Phosphonates import ATP-binding protein PhnC Shigella sonnei (strain Ss046)
O29527 6.31e-24 101 33 2 195 3 AF_0731 Putative ABC transporter ATP-binding protein AF_0731 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q2NTI7 7.71e-24 100 32 4 218 3 znuC Zinc import ATP-binding protein ZnuC Sodalis glossinidius (strain morsitans)
Q9HQ18 7.98e-24 103 35 5 219 1 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R5G4 7.98e-24 103 35 5 219 3 btuD Cobalamin import ATP-binding protein BtuD Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O34314 8.34e-24 100 33 8 219 3 ytlC Uncharacterized ABC transporter ATP-binding protein YtlC Bacillus subtilis (strain 168)
Q13LC4 9.45e-24 101 30 11 264 3 phnC Phosphonates import ATP-binding protein PhnC Paraburkholderia xenovorans (strain LB400)
Q0T9T7 1.12e-23 100 30 5 216 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q74LQ3 1.15e-23 100 32 5 215 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q9CK97 1.16e-23 102 31 3 231 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q3ABN1 1.18e-23 100 33 3 213 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9CIN4 1.27e-23 102 34 7 231 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. lactis (strain IL1403)
Q1R3F6 1.28e-23 100 30 5 216 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain UTI89 / UPEC)
Q8FAV1 1.34e-23 100 30 5 216 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q73XU8 1.35e-23 102 37 4 192 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q045Z7 1.35e-23 100 28 5 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
P70970 1.36e-23 100 31 6 219 3 ecfAB Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus subtilis (strain 168)
Q8RQL7 1.48e-23 99 30 6 237 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q38WL5 1.64e-23 101 31 2 219 3 metN Methionine import ATP-binding protein MetN Latilactobacillus sakei subsp. sakei (strain 23K)
Q1WSB9 1.91e-23 100 32 6 215 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q24QI5 1.95e-23 101 32 6 232 3 metN Methionine import ATP-binding protein MetN Desulfitobacterium hafniense (strain Y51)
Q8ZR89 2e-23 101 32 5 246 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q32EX7 2.01e-23 99 33 6 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
P46903 2.06e-23 99 30 4 205 1 natA ABC transporter ATP-binding protein NatA Bacillus subtilis (strain 168)
D8KFN1 2.32e-23 101 33 7 231 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain NZ9000)
P0CI33 2.32e-23 101 33 7 231 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain MG1363)
Q8CMU4 2.47e-23 99 30 4 218 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HKQ8 2.47e-23 99 30 4 218 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4FQ27 2.51e-23 99 30 6 234 3 znuC Zinc import ATP-binding protein ZnuC Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q9ZKW3 2.58e-23 99 31 7 256 3 jhp_0821 Probable iron chelatin transport ATP-binding protein jhp_0821 Helicobacter pylori (strain J99 / ATCC 700824)
Q6D2F6 2.59e-23 100 35 8 230 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8XXY9 2.69e-23 100 30 4 216 3 nodI Nod factor export ATP-binding protein I Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8XDV7 2.69e-23 99 29 6 227 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli O157:H7
Q81LM1 2.76e-23 99 28 4 215 1 fpuC Petrobactin import ATP-binding protein FpuC Bacillus anthracis
Q046T0 2.78e-23 99 30 5 223 3 phnC Phosphonates import ATP-binding protein PhnC Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q132E8 2.95e-23 99 29 5 233 3 phnC Phosphonates import ATP-binding protein PhnC Rhodopseudomonas palustris (strain BisB5)
Q8D385 3.04e-23 98 30 3 216 3 znuC Zinc import ATP-binding protein ZnuC Wigglesworthia glossinidia brevipalpis
Q1CCR9 3.07e-23 99 33 7 204 3 tauB Taurine import ATP-binding protein TauB Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZJD0 3.07e-23 99 33 7 204 3 tauB Taurine import ATP-binding protein TauB Yersinia pestis
Q1C2S1 3.07e-23 99 33 7 204 3 tauB Taurine import ATP-binding protein TauB Yersinia pestis bv. Antiqua (strain Antiqua)
Q57S53 3.27e-23 100 32 5 246 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella choleraesuis (strain SC-B67)
Q664P8 3.3e-23 99 33 7 204 3 tauB Taurine import ATP-binding protein TauB Yersinia pseudotuberculosis serotype I (strain IP32953)
O34631 3.35e-23 101 32 4 199 3 yvrA Uncharacterized ABC transporter ATP-binding protein YvrA Bacillus subtilis (strain 168)
Q8R7Y5 3.38e-23 99 30 6 220 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9AB70 3.51e-23 99 28 8 270 3 phnC Phosphonates import ATP-binding protein PhnC Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P61482 3.52e-23 98 34 6 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61481 3.52e-23 98 34 6 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhi
Q5PGR6 3.52e-23 98 34 6 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P16677 3.74e-23 99 29 6 217 3 phnC Phosphonates import ATP-binding protein PhnC Escherichia coli (strain K12)
Q4KKK8 3.76e-23 100 32 3 211 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6LKD4 3.94e-23 100 33 5 199 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q2FNX9 4.04e-23 99 32 5 225 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q1J255 4.16e-23 99 32 10 261 3 hmuV Hemin import ATP-binding protein HmuV Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q8ESM5 4.21e-23 98 28 5 246 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q97N51 4.41e-23 99 30 4 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q3Z300 4.56e-23 97 33 6 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q1RD37 4.56e-23 97 33 6 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q8FIM7 4.56e-23 97 33 6 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIV6 4.56e-23 97 33 6 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q134N9 4.67e-23 100 35 5 225 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB5)
Q5YVL8 4.81e-23 99 35 5 216 3 hmuV Hemin import ATP-binding protein HmuV Nocardia farcinica (strain IFM 10152)
Q329I3 4.99e-23 98 30 5 214 3 phnC Phosphonates import ATP-binding protein PhnC Shigella dysenteriae serotype 1 (strain Sd197)
P75957 5.06e-23 97 33 6 212 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
O54187 5.12e-23 99 31 5 241 3 SCO5958 Putative ABC transporter ATP-binding protein SCO5958 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q2YUY7 5.13e-23 98 30 5 232 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4ZZR8 5.15e-23 100 31 4 216 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
A1WXT0 5.16e-23 98 29 8 259 3 znuC Zinc import ATP-binding protein ZnuC Halorhodospira halophila (strain DSM 244 / SL1)
Q8DRS0 5.45e-23 99 31 6 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q1LJ08 5.58e-23 99 32 5 219 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q57QD7 5.61e-23 97 34 6 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
O05732 5.81e-23 98 31 6 246 3 HP_0888 Probable iron chelatin transport ATP-binding protein HP_0888 Helicobacter pylori (strain ATCC 700392 / 26695)
P94440 7.03e-23 99 31 5 222 1 lnrL Linearmycin resistance ATP-binding protein LnrL Bacillus subtilis (strain 168)
Q8YUV1 7.2e-23 98 31 5 216 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q31TP8 7.23e-23 98 29 5 216 3 phnC Phosphonates import ATP-binding protein PhnC Shigella boydii serotype 4 (strain Sb227)
Q1CFH7 7.4e-23 99 35 4 201 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZH38 7.4e-23 99 35 4 201 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis
Q1CAK4 7.4e-23 99 35 4 201 3 metN1 Methionine import ATP-binding protein MetN 1 Yersinia pestis bv. Antiqua (strain Antiqua)
Q83RS0 7.57e-23 97 34 6 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella flexneri
Q9HMZ4 7.88e-23 97 33 4 205 3 VNG_2317G Putative ABC transporter ATP-binding protein VNG_2317G Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q82WT5 8.28e-23 99 31 3 229 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0I2Z4 8.42e-23 99 31 9 235 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
Q7N8M2 9.23e-23 99 34 1 196 3 metN Methionine import ATP-binding protein MetN Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7NX01 9.44e-23 99 32 5 234 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5PCG9 9.54e-23 99 31 5 246 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q07PZ0 9.59e-23 98 32 7 248 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Rhodopseudomonas palustris (strain BisA53)
Q032A0 1.01e-22 99 33 7 231 3 metN Methionine import ATP-binding protein MetN Lactococcus lactis subsp. cremoris (strain SK11)
Q6F9P2 1.01e-22 99 30 2 211 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6D1C4 1.06e-22 99 30 4 249 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q87J32 1.08e-22 97 27 10 263 3 hmuV Hemin import ATP-binding protein HmuV Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q4KC87 1.11e-22 99 34 6 208 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9PJX9 1.14e-22 97 30 5 239 3 TC_0697 Probable metal transport system ATP-binding protein TC_0697 Chlamydia muridarum (strain MoPn / Nigg)
Q70GD4 1.19e-22 97 27 6 230 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damsela subsp. piscicida
Q31ZH4 1.23e-22 96 34 6 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella boydii serotype 4 (strain Sb227)
Q6D664 1.23e-22 97 32 5 207 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9K876 1.31e-22 99 34 6 216 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q81A96 1.32e-22 97 31 4 214 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q74IV9 1.32e-22 99 31 8 254 3 metN Methionine import ATP-binding protein MetN Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q72Y96 1.44e-22 99 29 3 222 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8ENU2 1.45e-22 99 32 5 215 3 metN2 Methionine import ATP-binding protein MetN 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8U4K3 1.76e-22 98 32 5 214 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q831K6 1.8e-22 98 29 2 217 1 metN2 Methionine import ATP-binding protein MetN 2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q87UN4 1.82e-22 98 31 3 211 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q28QF9 1.85e-22 97 31 10 260 3 hmuV Hemin import ATP-binding protein HmuV Jannaschia sp. (strain CCS1)
Q4L9P7 1.93e-22 97 31 4 218 3 phnC Phosphonates import ATP-binding protein PhnC Staphylococcus haemolyticus (strain JCSC1435)
O34392 1.96e-22 96 34 5 187 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q8X8E3 2.08e-22 96 33 6 212 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O157:H7
Q8DMY0 2.09e-22 97 29 4 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04HV8 2.09e-22 97 29 4 228 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q13VD7 2.11e-22 98 32 5 222 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q73F66 2.14e-22 97 31 6 218 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q65M34 2.14e-22 98 30 2 208 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8CUY0 2.31e-22 96 28 6 244 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q4L4R9 2.34e-22 98 32 6 225 3 metN Methionine import ATP-binding protein MetN Staphylococcus haemolyticus (strain JCSC1435)
Q04BY7 2.34e-22 97 31 7 269 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q0B697 2.37e-22 97 31 7 244 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q5QXD0 2.39e-22 96 30 7 230 3 hmuV Hemin import ATP-binding protein HmuV Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q2JLH7 2.39e-22 97 31 5 220 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q48PU6 2.41e-22 98 31 4 216 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q6G098 2.42e-22 96 29 8 247 3 hmuV Hemin import ATP-binding protein HmuV Bartonella quintana (strain Toulouse)
Q02QM1 2.7e-22 97 30 6 229 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q83P97 2.72e-22 96 29 6 217 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri
Q0SXV5 2.72e-22 96 29 6 217 3 phnC Phosphonates import ATP-binding protein PhnC Shigella flexneri serotype 5b (strain 8401)
Q4KK46 2.74e-22 98 27 3 227 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q39B28 2.77e-22 96 30 6 243 3 hmuV Hemin import ATP-binding protein HmuV Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q160G4 2.81e-22 96 31 7 250 3 hmuV Hemin import ATP-binding protein HmuV Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1IGZ0 2.86e-22 97 31 5 219 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q3KJS6 2.88e-22 98 28 3 228 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas fluorescens (strain Pf0-1)
Q815Y7 2.89e-22 97 29 2 211 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q02Z10 3.01e-22 99 35 10 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. cremoris (strain SK11)
Q1GBJ0 3.14e-22 96 31 7 269 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q9HYL7 3.15e-22 96 30 6 229 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A2RH10 3.29e-22 96 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J450 3.29e-22 96 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC9 3.29e-22 96 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJD0 3.29e-22 96 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J983 3.29e-22 96 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CMM8 3.29e-22 96 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B6 3.29e-22 96 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q99XI2 3.29e-22 96 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M1
Q9I6L0 3.35e-22 97 35 5 208 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q659V4 3.45e-22 96 27 6 230 3 hmuV Hemin import ATP-binding protein HmuV Photobacterium damselae subsp. damselae
Q48QM3 3.47e-22 96 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q67JX4 3.63e-22 96 34 3 202 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q8ETV6 4.08e-22 96 33 5 203 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8D653 4.5e-22 97 33 3 199 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
Q18C09 4.81e-22 97 32 3 219 3 metN Methionine import ATP-binding protein MetN Clostridioides difficile (strain 630)
Q9KLQ5 4.85e-22 97 32 6 202 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q92V71 4.87e-22 96 32 6 217 3 phnC Phosphonates import ATP-binding protein PhnC Rhizobium meliloti (strain 1021)
Q1GIE5 5.01e-22 97 30 5 219 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
Q6N9W0 5.13e-22 97 33 2 218 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
D5AQY6 5.2e-22 95 33 6 218 1 nikO Nickel import ATP-binding protein NikO Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q839D4 5.27e-22 96 32 8 227 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Enterococcus faecalis (strain ATCC 700802 / V583)
P56344 5.27e-22 95 33 6 212 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q04FM1 5.42e-22 96 31 7 225 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q8Z8R5 5.44e-22 97 31 5 246 3 metN2 Methionine import ATP-binding protein MetN 2 Salmonella typhi
Q9RKC6 5.47e-22 95 31 7 255 3 SCO3161 Putative ABC transporter ATP-binding protein SCO3161 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q81XL3 5.49e-22 97 28 3 222 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus anthracis
Q82HA2 5.51e-22 95 32 4 221 3 SAV_3608 Putative ABC transporter ATP-binding protein SAV_3608 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q03ZL5 5.68e-22 96 32 4 199 1 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q1R597 5.74e-22 95 28 7 235 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli (strain UTI89 / UPEC)
Q65S66 5.87e-22 97 30 7 231 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q4QMH4 5.96e-22 97 29 2 237 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
Q7N3S7 6.02e-22 95 27 8 253 3 hmuV Hemin import ATP-binding protein HmuV Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q7VI92 6.04e-22 97 31 4 222 3 metN Methionine import ATP-binding protein MetN Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q631Y4 6.13e-22 97 28 3 222 3 metN3 Methionine import ATP-binding protein MetN 3 Bacillus cereus (strain ZK / E33L)
P0CZ27 6.14e-22 95 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0CZ26 6.14e-22 95 30 6 238 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9K789 6.26e-22 97 32 5 221 3 metN Methionine import ATP-binding protein MetN Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7VM95 6.37e-22 97 30 3 226 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5FUV5 6.4e-22 94 36 5 187 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Gluconobacter oxydans (strain 621H)
O70014 6.63e-22 95 28 7 235 1 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae
Q9WYI7 6.81e-22 94 34 2 193 3 TM_0352 Uncharacterized ABC transporter ATP-binding protein TM_0352 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O57896 6.85e-22 97 30 6 215 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8FCJ1 7.05e-22 95 28 7 235 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TBU8 7.05e-22 95 28 7 235 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8EPK1 7.06e-22 97 32 5 217 3 metN1 Methionine import ATP-binding protein MetN 1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2JPW6 7.1e-22 95 31 8 245 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q5WIL7 7.13e-22 95 29 6 262 3 phnC Phosphonates import ATP-binding protein PhnC Shouchella clausii (strain KSM-K16)
Q4KB64 7.22e-22 97 29 5 220 3 modC Molybdenum import ATP-binding protein ModC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8UBY6 7.62e-22 94 31 6 215 3 thiQ Thiamine import ATP-binding protein ThiQ Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8X5N2 7.81e-22 95 28 7 235 3 hmuV Hemin import ATP-binding protein HmuV Escherichia coli O157:H7
Q57293 7.86e-22 97 32 7 217 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
Q18H36 8.14e-22 95 31 5 209 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q6D5H7 8.18e-22 96 28 6 232 3 metN1 Methionine import ATP-binding protein MetN 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3KK97 8.38e-22 96 32 3 212 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain Pf0-1)
Q9X1Z1 8.52e-22 95 28 4 230 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6HBS0 9.25e-22 96 28 3 222 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q5FL41 9.52e-22 97 33 5 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q07LU3 9.59e-22 95 28 6 238 3 hmuV Hemin import ATP-binding protein HmuV Rhodopseudomonas palustris (strain BisA53)
Q32AY3 9.88e-22 94 28 7 235 3 hmuV Hemin import ATP-binding protein HmuV Shigella dysenteriae serotype 1 (strain Sd197)
Q1IGN4 9.95e-22 97 29 3 218 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas entomophila (strain L48)
Q667L9 1.03e-21 96 34 4 201 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q6HPM9 1.13e-21 95 29 6 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ1 1.13e-21 95 29 6 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus anthracis
Q13LD8 1.14e-21 97 29 3 233 3 metN2 Methionine import ATP-binding protein MetN 2 Paraburkholderia xenovorans (strain LB400)
Q0SFW6 1.16e-21 96 31 3 232 3 metN2 Methionine import ATP-binding protein MetN 2 Rhodococcus jostii (strain RHA1)
Q92L31 1.17e-21 94 33 6 218 3 thiQ Thiamine import ATP-binding protein ThiQ Rhizobium meliloti (strain 1021)
Q2NRN5 1.24e-21 96 32 1 198 3 metN Methionine import ATP-binding protein MetN Sodalis glossinidius (strain morsitans)
Q11ID5 1.24e-21 94 33 7 230 3 hmuV Hemin import ATP-binding protein HmuV Chelativorans sp. (strain BNC1)
Q1LQB5 1.26e-21 95 30 8 239 3 phnC1 Phosphonates import ATP-binding protein PhnC 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A0R8K9 1.27e-21 95 29 6 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus thuringiensis (strain Al Hakam)
Q48J29 1.29e-21 96 31 5 222 3 modC Molybdenum import ATP-binding protein ModC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P45247 1.36e-21 94 32 6 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKQ9 1.36e-21 94 32 6 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain 86-028NP)
P57403 1.38e-21 94 30 4 228 3 znuC Zinc import ATP-binding protein ZnuC Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q7MPC5 1.4e-21 94 30 4 210 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain YJ016)
Q8DE95 1.4e-21 94 30 4 210 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio vulnificus (strain CMCP6)
Q0I5E9 1.41e-21 96 31 3 231 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q63R24 1.41e-21 95 29 8 247 3 phnC Phosphonates import ATP-binding protein PhnC Burkholderia pseudomallei (strain K96243)
Q3JNY2 1.41e-21 95 29 8 247 3 phnC Phosphonates import ATP-binding protein PhnC Burkholderia pseudomallei (strain 1710b)
Q8PSR0 1.42e-21 97 30 4 228 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8PSR0 1.06e-14 77 29 7 230 3 MM_3016 Putative ABC transporter ATP-binding protein MM_3016 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P74981 1.43e-21 94 27 9 274 1 hmuV Hemin import ATP-binding protein HmuV Yersinia enterocolitica
Q6HFB5 1.46e-21 94 30 4 214 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q733D6 1.47e-21 94 30 4 214 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus cereus (strain ATCC 10987 / NRS 248)
Q89LP2 1.48e-21 96 33 2 215 3 metN Methionine import ATP-binding protein MetN Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q81J15 1.54e-21 95 29 6 222 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q62H59 1.58e-21 95 29 8 247 3 phnC Phosphonates import ATP-binding protein PhnC Burkholderia mallei (strain ATCC 23344)
Q9CGD4 1.61e-21 97 34 10 233 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. lactis (strain IL1403)
Q5L222 1.65e-21 95 30 7 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
P9WQL3 1.65e-21 96 33 7 242 1 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQL2 1.65e-21 96 33 7 242 3 modC Molybdenum import ATP-binding protein ModC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8P4S7 1.74e-21 95 30 4 238 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQD2 1.74e-21 95 30 4 238 3 metN Methionine import ATP-binding protein MetN Xanthomonas campestris pv. campestris (strain 8004)
Q73KT5 1.75e-21 94 29 6 264 3 TDE_2132 Putative ABC transporter ATP-binding protein TDE_2132 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q637E2 1.79e-21 94 30 4 214 3 phnC Phosphonates import ATP-binding protein PhnC Bacillus cereus (strain ZK / E33L)
Q5SSE9 1.8e-21 98 27 5 266 1 Abca13 ATP-binding cassette sub-family A member 13 Mus musculus
Q5SSE9 1.99e-11 68 24 4 211 1 Abca13 ATP-binding cassette sub-family A member 13 Mus musculus
Q0A9E2 1.83e-21 94 31 7 238 3 znuC Zinc import ATP-binding protein ZnuC Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q608V9 1.91e-21 95 32 7 227 3 modC Molybdenum import ATP-binding protein ModC Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6NBT1 1.92e-21 95 35 4 199 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q9RR46 1.93e-21 96 33 5 196 1 gbuA Glycine betaine/carnitine transport ATP-binding protein GbuA Listeria monocytogenes serotype 1/2a (strain 10403S)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_05295
Feature type CDS
Gene znuC
Product manganese/iron ABC transporter ATP-binding protein
Location 50579 - 51463 (strand: 1)
Length 885 (nucleotides) / 294 (amino acids)

Contig

Accession ZDB_362
Length 257361 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1814
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1121 Inorganic ion transport and metabolism (P) P ABC-type Mn2+/Zn2+ transport system, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11607 manganese/iron transport system ATP-binding protein ABC transporters -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG012580 iron/manganese ABC transporter ATP-binding protein SitB VF1116 Nutritional/Metabolic factor

Protein Sequence

MSDQFSKPQLVVDNATVTYNNGHTAIFDASFSIEGGSICALVGINGSGKSTLFKTIMGLVTPTQGRVTLNDEPVRAALKKNVIAYVPQTEEVDWNFPVLVSDVVMMGRYGKMGFLRIPGKEDKKAVADALERVGLTGLGHRQIGELSGGQKKRVFLARALAQNGKVLLLDEPFTGVDVKTENAIIDLLRSLREEGHLVLVSTHNLGSVPEFCDHVILINRTVLDSGPTATTFTQKNLERTFGGVLRHINLSGPDLHDDDDPRSLTVITDDERAAVFYGHQDNLTVKTGSKEEQP

Flanking regions ( +/- flanking 50bp)

ATTGATCTGCTCAATACCACTGTAGATACTATCGTCAAAGGATTTCATCAATGAGTGATCAATTCAGCAAACCACAGCTGGTTGTCGATAACGCCACTGTCACTTATAACAACGGCCATACCGCGATTTTTGATGCCAGTTTCAGCATAGAGGGCGGCTCTATCTGCGCCCTCGTCGGTATTAACGGCAGCGGTAAATCCACCCTGTTTAAAACTATTATGGGGCTGGTCACACCGACACAGGGCCGGGTGACACTGAATGATGAACCGGTGCGTGCTGCGCTGAAAAAGAATGTGATTGCCTATGTCCCGCAGACAGAAGAAGTGGACTGGAACTTTCCTGTTCTGGTCTCTGATGTGGTGATGATGGGCCGTTACGGAAAAATGGGTTTTCTGCGCATTCCCGGTAAAGAAGACAAAAAAGCTGTCGCCGATGCACTGGAACGTGTCGGTCTTACCGGGCTGGGTCACCGCCAGATAGGCGAGCTTTCCGGCGGCCAGAAAAAACGTGTGTTTCTGGCCCGCGCGCTGGCACAAAACGGTAAAGTATTGCTGCTGGATGAGCCTTTTACCGGCGTGGATGTCAAAACAGAGAATGCCATTATCGATTTACTGCGCTCACTGCGCGAAGAGGGGCATCTGGTGCTGGTCTCCACCCACAACCTCGGCAGTGTGCCGGAATTCTGTGATCATGTGATCCTGATAAACCGTACTGTGCTCGACAGCGGCCCGACCGCCACCACGTTTACCCAGAAAAACCTGGAAAGAACCTTCGGCGGAGTGCTGCGTCATATCAATCTGTCCGGGCCGGATCTGCATGACGACGATGACCCGCGTTCACTGACCGTTATTACCGATGACGAACGCGCCGCTGTCTTCTACGGCCATCAGGATAATCTGACGGTGAAGACCGGCAGTAAGGAAGAGCAGCCATGACAGAGCTGTTACTTCAGCCGTTTGAATACAACTATATGGTGAAAGCCATC